ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

AY512381 (MIC3)

gi|40549146|gb|AY512381.1|AY512381S1 Eimeria tenella microneme protein MIC3 gene, partial cds, a gene from Eimeria tenella

Compiled localisation
during not early first generation schizont and not early second generation schizont
apical during mature first generation schizont and mature second generation schizont
microneme during sporozoite

Who localised this protein by microscopy?

Labbe, M., de Venevelles, P., Girard-Misguich, F., Bourdieu, C., Guillaume, A., Pery, P.
Eimeria tenella microneme protein EtMIC3: identification, localisation and role in host cell infection. (2005 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

during not early first generation schizont and not early second generation schizont, apical during mature first generation schizont and mature second generation schizont, microneme during sporozoite
  • "A specific immunostaining was observed in mature first-generation schizonts (Fig. 3C), with a labelling at the apex of the neoformed merozoites. It is interesting to observe that early first-generation schizonts were not stained at all (Fig. 3C). Mature second-generation schizonts were obtained after intestinal scrapings of four-day infected chickens. A specific staining at the apex of the second-generation neoformed merozoites was also shown inside the schizont with mAb A6 (Fig. 3D). As we observed with mAb A6, labelling with mAb N8 disappeared in immature schizonts and was again observed at the mature stage when merozoites are formed. Labelling was also concentrated at the apical end of the first- and second-generation merozoites (data not shown)."
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: not during early first generation schizont and early second generation schizont, apical during mature first generation schizont and mature second generation schizont, microneme during sporozoites
  • Other genes localised in this publication: gi|209414697|emb|Z71755.2| Eimeria tenella mRNA for acidic microneme protein precursor, clone Etmic-2

Orthology

OrthoMCL

This species does not currently exist in the OrthoMCL database.

Amino Acid Sequence

>AY512381 gi|40549146|gb|AY512381.1|AY512381S1 Eimeria tenella microneme protein MIC3 gene, partial cds
MKVYICVGAVAFLSACRTQALRLSRSFLSLSAEAESTTRLAARRESLQDALDEECSQQASVACRSGLQDYCNEAVFARYD
GIKGSPSSKQWRCYTEGALDLEAAGPGCVNSCGAATMCLGAFNSRSVAYLTRNNELTSILKLRTQEFCSAPAPTLQEALD
RKCAQFGKESCNSGLASYCGAAIYARYDKGNSSQQTKEWRCYIEKELDFSKSGDGCVDDCGSMTSCRGSVSGPSTSHLTR
PSELQAVIDSDKSNYCTDKSEQQPSQATPPPEIPEGTPEESETEDPSGSQAVPEALQHALDAFCVEEGEKACSNGLRAYC
NSAMYARKDVGNTTQKTKEWRCYAASEIDFAVSADVCADNCGNITSCSGAVNGVSTSHLTRNPQIEELIKMEKEVYCNPE
IEKGSESTGAVDSSESEVVPPPEIPEGTPEESETEDPSGSQAVPEALQ

Proteomics

Found in:

Not found in:

Gene-Specific Links for AY512381

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins