ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

AJ245536 (MIC5)

gi|5708121|emb|AJ245536.1| Eimeria tenella mRNA for microneme protein 5 (mic-5 gene), a gene from Eimeria tenella

Compiled localisation
apical during early merozoite and extracellular sporozoite
not surface during extracellular sporozoite
surface during host cell exposed extracellular sporozoite
during not intracellular sporozoite
cytoplasm during after sporozoite invasion of enteric cells
peripheral during early merozoite

Who localised this protein by microscopy?

Brown, P. J., Billington, K. J., Bumstead, J. M., Clark, J. D., Tomley, F. M.
A microneme protein from Eimeria tenella with homology to the Apple domains of coagulation factor XI and plasma pre-kallikrein. (2000 Mar 15, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apical during early merozoite and extracellular sporozoite, not surface during extracellular sporozoite, surface during host cell exposed extracellular sporozoite, during not intracellular sporozoite, cytoplasm during after sporozoite invasion of enteric cells, peripheral during early merozoite
  • "In isolated sporozoites (Fig. 3B) EtMIC 5 is within the apical tip of the parasite and detected only after permeabilisation of the parasite membrane. There is no surface staining of parasites fixed with PFA. However, when sporozoites are added to host cells ( Fig. 3C), EtMIC 5 is clearly detectable on the surface of PFA-fixed extracellular sporozoites (Esp), most dominantly at the apical end. In contrast, intracellular sporozoites (Isp) do not stain, demonstrating the efficacy of the PFA treatment for cross-linking plasma membranes. ... After invasion, EtMIC 5 is found within the sporozoite, concentrated mainly at the apical tip. As sporozoites develop into immature schizonts (Panels BヨD, note the single, fused refractile body diagnostic of early schizogony), EtMIC 5 is initially found throughout the whole schizont (Fig. 4B) then disperses ( Fig. 4C) and eventually disappears ( Fig. 4D). This staining sequence suggests that EtMIC 5 in the early schizont represents residual protein that was brought in by the invading sporozoite. No further staining is seen until late in schizogony, after nuclear division and cytoplasmic differentiation, when daughter merozoites are nearing maturation. EtMIC 5 is then detected strongly at the periphery of the schizont ( Fig. 4E) and is clearly associated with the apical third of the newly formed merozoites ( Fig. 4F)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apical and not surface during isolated extracellular sporozoite, surface during host-cell exposed extracellular sporozoite, not during intracellular sporozoite, cytoplasm during after sporozoite invasion, peripheral and apical during early merozoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

This species does not currently exist in the OrthoMCL database.

Amino Acid Sequence

>AJ245536 gi|5708121|emb|AJ245536.1| Eimeria tenella mRNA for microneme protein 5 (mic-5 gene)
MGRIRRAAAVAGLGITLLPRDGTEAWLAPNRRHAEVSGTFEAPPSMVETQWGSPYTYIPQVTVNEKAADFFFASVLESVA
ELPAEGQGGVEAGEGAEAGQGGEAAGPQPKACEALNADADRSHVFQTIQGIETEEACQNFCGQTKGCVAAILEGATCSLM
RALRGVKEGSGILVVQTCDNSCFSQGRKLSSEGKSLGTANNANICQAMCQGEDGCIGFSWNRSSKECTSHPSEVGSAEDK
ASVSGPRDGCSLNVRPVDQAGKCTLQVDLTGDAGNHIEAPNVSTIEQCRRECLLDKDCKWFTFNEVTKICYHKKKVGNIA
YGLKGDHTASRLCDASCLQKDVKFAGNAYKTLNVKYMQLCIYNCFIDGKCQRWSWDSKSTACNLFDGTGVADSSANQAGV
WSGPKEGCAADTLYGREAPSCAVRGSRYGTIPISTQTVDNATLCQQQCQKSSMCEAFSYDIKGKVCYLHVAYAAKLKRAN
YNFISGPRQCAGCSTNGSEYSGKALQEMGSEVETAEECQLLCQATSGCEVYSFLGSACKLLGSGESKKNVLATSGVKYCT
GVCDILGFRAPRREFGYALLLKGKSLEDCRKACSADQKCTNFTSWLNKECYIKDDQDHRMQEPIPEATSGWVSCSTCFRQ
GVGYKATEANLLWTLPSENAEECRQRCEVMESCGRFSYDAASKACSMLSGEGEEVQGENLVSGPPRCTRRDTCYQNGVSF
TGGKAISEAKAASSQACQELCEKDAKCRFFTLASGKCSLFADDAALRPTKSDGAVSGNKRCILLEDICEESNIQYSSGDL
DSPLTAKNSQECMALCYKDPQCRIWTYLVPEKQCLLKSITGFSNRAKATSQKKSGGRLGCARCTRAAIAFGGKELQTVSG
LPHETVCQFACELNKKCKFFTFDQVSKSCKLFASDSERLPAENTVLSGPRRC

Proteomics

Found in:

Not found in:

Gene-Specific Links for AJ245536

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins