ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

AF042329 (Hsp90)

gi|2792526|gb|AF042329.1| Eimeria tenella heat shock protein 90 (hsp90) mRNA, complete cds, a gene from Eimeria tenella

Compiled localisation
apical during sporozoite
cytosol during schizont and sporozoite
parasitophorous vacuole membrane and parasitophorous vacuole during schizont
merozoite cytosol

Who localised this protein by microscopy?

Peroval, M., Pery, P., Labbe, M.
The heat shock protein 90 of Eimeria tenella is essential for invasion of host cell and schizont growth. (2006 Sep, Int J Parasitol) PubMed / full text
   more detail about this publication

apical during sporozoite, cytosol during schizont and sporozoite, parasitophorous vacuole and parasitophorous vacuole membrane during schizont, merozoite cytosol
  • "EtHsp90 localisation was investigated in sporozoites and during first schizogony. EtHsp90 had a homogenous distribution in the cytoplasm of sporozoites incubated in PBS (Fig. 3A). On the contrary, in sporozoites incubated in CM, EtHsp90 was concentrated at the apical end of the sporozoites (Fig. 3B). Observations 2┬áh p.i. show the persistence of apical localisation in intracellular sporozoites (Fig. 3C). Later, this labelling had uniform distribution in immature and mature schizonts (Fig. 3E and F). Moreover, EtHsp90 was detected in PV and particularly concentrated in the PV membrane (PVM) (Fig. 3D and E). In free merozoites, immunostaining was principally localised near the nucleus (Fig. 3G)"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Concentrated apical and cytosol during sporozoite, cytosol and PV and PVM during schizont, cytosol in merozoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

This species does not currently exist in the OrthoMCL database.

Amino Acid Sequence

>AF042329 gi|2792526|gb|AF042329.1| Eimeria tenella heat shock protein 90 (hsp90) mRNA, complete cds
MENKETFAFNADIQQLMSLIINTFYSNKEIFLRELISNASDALDKIRYEAITEPEKLKTKPELFIRLIPDKANNTLTIEN
SGIGMTKADLVNNLGTIARSGTKAFMEALQAGGDISMIGQFGVGFYSAYLVADSVTVVSKHNDDEQYVWESAAGGSFTVQ
KDDKYEPLGRGTRIILHLKEDQGEYLEERRLKDLVKKHSEFISFPIELAVEKTHEREVTESEDEEEKKADEKAEEKEGEE
KKEGEEKKEGEEEKKEKTGKTKKVQEVTREWEQLNKQKPLWMRKPEEVTEEEYASFYKSLSNDWEEHLAVKHFSVEGQLE
FKALLFVPKRAPFDLFETRKKRNNIKLYVRRVFIMDDCEDIIPEWLNFVKGVVDSEDLPLNISRESLQQNKILKVIRKNL
VKKCLEMFAEIEEKKENYAKFYEQFSKNLKLGIHEDSANRAKIAELLRFHSSKSGEDMVSFKEYVDRMKEGQKDIYYITG
ESRQTVANSPFLEKLTKKGYEVLYMTDPIDEYAVQQLKEFDNHKLRCCTKEGLEIDESEEEKKKFEELKAEFEPLLKLIK
EVLHDKVDKVVLSNRITDSPCVLVTTEFGWSANMERIMKAQALRDNSMTSYMVSKKTMEVNGHHSIMIEIKNKAAVDKSD
KTVKDLIWLLYDTALLTSGFSLEEPTQFAARIHRMIKLGLSIDDDEEAKDDDLPPLEEVEGAADEASKMEEVD

Proteomics

Found in:

Not found in:

Gene-Specific Links for AF042329

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins