ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

cgd8_4740 (SFP-PPT, PPTase) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

phosphopantetheinyl transferase, a gene from Cryptosporidium parvum

Compiled localisation
cytosol during merozoite containing meront and sporozoite

Who localised this protein by microscopy?

Ctrnacta, V., Ault, J. G., Stejskal, F., Keithly, J. S.
Localization of pyruvate:NADP+ oxidoreductase in sporozoites of Cryptosporidium parvum. (2006 Jul-Aug, J Eukaryot Microbiol) PubMed / full text
   more detail about this publication

cytosol during sporozoite

Cai, X., Herschap, D., Zhu, G.
Functional characterization of an evolutionarily distinct phosphopantetheinyl transferase in the apicomplexan Cryptosporidium parvum. (2005 Jul, Eukaryot Cell) PubMed / full text
   more detail about this publication

cytosol during merozoite containing meront and sporozoite
  • "The CpSFP-PPT protein was also detected in the cytosol of all parasite life cycle stages by indirect immunofluorescence microscopy (Fig. 6), which agrees with the lack of any signal peptide sequence and is congruent with the cytosolic nature of its substrates (CpFAS1 and CpPKS1) (44)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: IOWA
  • Gene model mapping comments: blast from AY856092, annotation matches, gene model inconsistent?
  • Localisation record: cytosol during sporozoite and merozoite containing meront
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13074

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>cgd8_4740 phosphopantetheinyl transferase
IRYKILDDRKRSLLSVLLMKLALMNYYDISPKQVKIIREKGMKPYFKYDSESDSLLHFNVSHDGDVVVIILSKYMVGIDI
MKTELSPSRVQLSNNIMEANEKFLNNMKNVFHPSEWEYIQKDISKFMHYWTIKESFVKYIGLGLYVDPRRLLIDSSLVKE
NHQCNLNSPYLKQSNIYLDNQLQVRKSILLNISIYILINATEYVKLIYCLIFRIVRSIHLTKLFPIIIFLSVYQKVILRN
STHTIFLAIKLSILMSLRDHNFVKILL

Proteomics

Found in:

Not found in:

Gene-Specific Links for cgd8_4740

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins