ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

cgd7_4020 (GP900, gp900) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

cryptopsoridial mucin, large thr stretch, signal peptide sequence, a gene from Cryptosporidium parvum

Compiled localisation
surface during merozoite and sporozoite
microneme during extracellular sporozoite and intracellular stages
inner surface of the oocyst wall and tethers on inner surface of the oocyst wall during oocyst
large electron-translucent vesicles during sporozoite

Who localised this protein by microscopy?

Chatterjee, A., Banerjee, S., Steffen, M., O'Connor, R. M., Ward, H. D., Robbins, P. W., Samuelson, J.
Evidence for mucin-like glycoproteins that tether sporozoites of Cryptosporidium parvum to the inner surface of the oocyst wall. (2010 Jan, Eukaryot Cell) PubMed / full text
   more detail about this publication

inner surface of the oocyst wall and tethers on inner surface of the oocyst wall during oocyst, large electron-translucent vesicles and surface during sporozoite
  • "A monoclonal antibody (Ab) to gp900 (4G12 labeled green) binds to the inner surface of broken oocyst walls (Set A) and to the outer surface of a sporozoite (B)."
  • Microscopy type: Fixed light
  • Microscopy method: monoclonal antibody
  • Strain: Iowa
  • Gene model mapping comments: inferred from another publication
  • Localisation record: inner surface of oocyst walls during oocyst, outer surface during sporozoite
  • Other genes localised in this publication: CpCOWP1, oocyst wall protein with type I and type II cysteine-rich repeats, conserved hypothetical protein
  • "Immuno-EM shows protein A-gold binding to anti-gp900 antibodies, which react with tethers (arrows) on the inner surface of the oocyst walls (OW) and to large, electron-translucent vesicles (ETV) in sporozoites (Spz)."
  • Microscopy type: EM
  • Microscopy method: monoclonal antibody
  • Strain: Iowa
  • Gene model mapping comments: inferred from another publication
  • Localisation record: tethers on inner surface of the oocyst wall during oocyst, large electron-translucent vesicles during sporozoites
  • Other genes localised in this publication: CpCOWP1, oocyst wall protein with type I and type II cysteine-rich repeats, conserved hypothetical protein

Tosini, F., Agnoli, A., Mele, R., Gomez Morales, M. A., Pozio, E.
A new modular protein of Cryptosporidium parvum, with ricin B and LCCL domains, expressed in the sporozoite invasive stage. (2004 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme during extracellular sporozoite
  • "The colocalization of these two antigens enforces the hypothesis that Cpa135 is localized in the micronemes, since SA40 is a portion of GP900 [14], which is a microneme-associated protein [25]."
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody SA40
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during free sporozoite
  • Comment: strain information not found
  • Other genes localised in this publication: CpCCp1/Cpa135

Bonnin, A., Ojcius, D. M., Souque, P., Barnes, D. A., Doyle, P. S., Gut, J., Nelson, R. G., Petersen, C., Dubremetz, J. F.
Characterization of a monoclonal antibody reacting with antigen-4 domain of gp900 in Cryptosporidium parvum invasive stages. (2001 Aug, Parasitol Res) PubMed / full text
   more detail about this publication

surface during merozoite and sporozoite
  • "In contrast, gp15 was present on the entire surface of sporozoites (Fig. 7C) as well as merozoites (Fig. 7D)."
  • Microscopy type: Light, EM
  • Microscopy method: monoclonal antibody
  • Strain: GCH1
  • Gene model mapping comments: Blast from AAC98153, annotation matches, gene model inconsistent?
  • Localisation record: entire surface during sporozoite and merozoite
  • Comment: gp40 and gp15 are 2 different products of the same gene
  • Other genes localised in this publication: -

Barnes, D. A., Bonnin, A., Huang, J. X., Gousset, L., Wu, J., Gut, J., Doyle, P., Dubremetz, J. F., Ward, H., Petersen, C.
A novel multi-domain mucin-like glycoprotein of Cryptosporidium parvum mediates invasion. (1998 Oct 30, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

surface during sporozoite, microneme during intracellular stages
  • "GP900 is stored in micronemes prior to appearance on the surface of invasive forms."
  • Microscopy type: EM
  • Microscopy method: monoclonal antibody directly to protein
  • Strain: AUCP-1
  • Gene model mapping comments: blast from AF068065, annotation doesn't match, gene model inconsistent?
  • Localisation record: surface during sporozoite, microneme during intracellular stages
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_57363

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>cgd7_4020 cryptopsoridial mucin, large thr stretch, signal peptide sequence
MVNIKVSSSAIALVAVIMNPLFSLAFKSSNRLEMRIESSGAVSNEKFVIPSLPSDLDPTTFLLIDSTGKKFSPYTGKHAD
ASTTSSAYSAPFELDVSGVPIEPNTRRMVDPVSLMLFDNSTGVMYDPNTNSILEGSIAGIRSESCIVSELNFTSTTGFTT
DTSMNWPVSITSGELKDPNKQATISGSRSCGWKQGYSIDSSTGFRVDSITGLPTDPYSNCPFNPVTGNLVSRSTGKTIPN
TYAGVYRSNETKTTEPSANTNFLLVDPKINAPCNSENSFEQGQIFDMGSKVYIPYTKCVGVKHTTTTTTTTTTTTTTTTT
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTKKPTTTTTTTTTTTTTTTTTTTTTTTTTTT
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTSTKKPTTTTTTTTTTTTTTTTTTTTTTTTTTT
TTTTTTKKPTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTKKPTTTTTTTTTTTTKKPTTTTTATTTTTTSET
ESVIKPDEWCWLEKNGECEAKGATYVGVIGKDGRIENGMAFTMIPNDDTHVRFRFKVKDVGNTISVRCRKGAGKLEFPDR
SLDFTIPPVAGHNSCSIIVGVSGDGKIHVSPYGSKDVSLISAPIQPSELFNEVYCDTCTAKYGAIHSGYQTSADFVTTTT
AKPTTTTTGAPGQPTTTTTGSPSKPTTTTTTKATTTTTTLNPIITTTTQKPTTTTTTKVPGKPPIATTTTTLKPIVTTTT
TKATTTTTTTVPTTTTTTKRDEMTTTTTPLPDIGDIEITPIPIEKMLDKYTRMIYDYNSGLLLDSNDEPIPGSQAGQIAD
TSNLFPVQTHKSTGLPIDPMVGLPFDPKSGNLVHPYTNQTMSGLSVSYLAAKNLTVDTDETYGLPIDTLTGYPLDPVSLI
PFNPETGELFDPISDEIMNGTIAGIVSGISASESLLSQKSAPIDPATNMVVGEFGGLLNPATGVMIPGSLGPSEQTPFSP
EIEDGGIIPPEVAAANADKFKLSIPPSVPESIPEKDQKIDSISELMYDIESGRLIGQVSKRPIPGSIAGDLNPIMKTPTQ
TDSVTGKPIDPTTGLPFNPPTGHLINPTNNNTMDSSFAGAYKYAVSNGIKTDNVYGLPVDEITGLPKDPVSDIPFNSTTG
ELVDPSTGKPINNSTAGIVSGKPGLPPIEDENGNLFDPSTNLPIDGNNQLVNPETNSTVSGSTSGTTKPKPGIPVNGGGV
VPDEEAKDQADKGKDGLIVPPTNSINKDPVTNTQYSNTTGNIINPETGKVIPGSLPGSLNYPSFNTPQQTDEITGKPVDT
VTGLPYDPSTGEIIDPATKLPIPGSVAGDEILTEVLNITTDEVTGLPIDLETGLPRDPVSGLPQLPNGTLVDPSNKKPIP
GSHSGFINGTSGEQSHEKDPSTGKPLDPNTGLPFDEDSGSLINPETGDKLQGSHSGTFMPVPGKPQGENGGIMTPEQILE
ALNKLPTSNEVNISPRPSSDAVPDRPTNTWWNKISGQTYQVDGKKTIPGSAASVIHTALGTPTQTDPTTGLPSDPSTGLP
FIPGFNVLVDPQTGEQIKGSVPYVSLYVKEKNIVTEAAYGLPVDPKTGFPIDPISYLPFAKNGELIDPISGKYFSGSIAG
FISGKAGSQSKSSDESGNPIDPSTNMPYDPKTGKLIDPESGIAIDNSVSGVFATVPGTAAPKKGGVIPESVAAEAAKKYF
AANVEGEGEGEEVPPPPESSSNIAIQAAGGASAAVGLVAAGVGAWYASRNRQEGEDDDDYADGFEAEYEEEEEEEGDEAA
NETVVTIERDSSFWNES

Proteomics

Found in:

Not found in:

Gene-Specific Links for cgd7_4020

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins