ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

cgd7_1730 (a135)

CpCCp1/Cpa135, a gene from Cryptosporidium parvum

Compiled localisation
apical and microneme during extracellular sporozoite
parasitophorous vacuole during intracellular stages

Who localised this protein by microscopy?

Tosini, F., Agnoli, A., Mele, R., Gomez Morales, M. A., Pozio, E.
A new modular protein of Cryptosporidium parvum, with ricin B and LCCL domains, expressed in the sporozoite invasive stage. (2004 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apical and microneme during extracellular sporozoite, parasitophorous vacuole during intracellular stages
  • "The Cpa135 protein was localized in the apical complex, and it was found to be secreted by sporozoites during their gliding. Cpa135 persisted during the intracellular stages of the parasite, and it defined the boundaries of the parasitophorous vacuole in the infected cells … Thus, Cpa135 overlayed the PVM after the host-cell infection, at least for the internal asexual stages."
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody directly to protein
  • Strain: ISSC6
  • Gene model mapping comments: blast from AJ006593, annotation matches
  • Localisation record: apical during free sporozoite, PV during intracellular stages
  • Comment: strain information found from genbank entry AJ006593
  • Comment: possibly microneme during free sporozoite because of colocalisation
  • Other genes localised in this publication: cryptopsoridial mucin, large thr stretch, signal peptide sequence
  • "The Cpa135 protein was localized in the apical complex, and it was found to be secreted by sporozoites during their gliding."
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody SA35
  • Strain:
  • Gene model mapping comments: blast from AJ006593, annotation matches
  • Localisation record: microneme during free sporozoite
  • Comment: strain information not found
  • Other genes localised in this publication: cryptopsoridial mucin, large thr stretch, signal peptide sequence

Orthology

OrthoMCL

Part of OrthoMCL group OG4_21070

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>cgd7_1730 CpCCp1/Cpa135
MRWKTFSFLLAFLSISLIVTAKDGESNYYFFKKAISSSTLVGSSFNGEFDPSNALNMGNSEWRSASNLSAEQQIVYTAFI
SATAKAIGLKIVWSSSPRETQIQVSPDGINYEIVVPNRRATQNEKEFTEDFMFDHSRDVRAVKIQMKAKPSQYIGIRQLV
ALGSGSPLAMIISGITDEKGDNCLQVIGGRVQDDFAQVDLDSCVYGISAGDGRELWKMGPNGQIISAASNPPKCLIVANG
DFSGSSPLLIQDCEIAEQAEDGRSFWEFNENSQLQVKGTNACVNQINKAGFGVGTTKLELSGTASSTMDALHTVDAAIDS
DIATYWASAAFESTGEHKVSINLSANMTYQLKNLRIDWEFPPFTYSIAAKVDGEMKQITKVEGNPSNTTLNEMNGVISDF
IQIVMEKPHPRYGKYSNKYLYGIREIELMTNNLRSVVSFCRDAALSKDARDKYFLNYVEDFNSKASEMVKSAARDVLSRT
KNLGVLNDRVNTLLPSIDECFTDKKEYVSRLEDYISNAKQLKEGLGAVKDEISVGVGNEPGDEPNLPAEDCFSIASRNPN
AISGFYWILPRCAPEPIRVWCDIKFGASYYIWNDGGNPGSYISVTSVSDIRKYCAHVGMEPLVLRNIEQISGIKSALGIM
GFKLSEGSGIPLAVDYGCLDGKCTGSYQDLRDGTTDLTSLVLSLASPESTATTLFGNDAVGLGFSENYLSFFNLKNSNIV
GIVCSTNVVPTQKQINHVDIDCDTVAYKNPIFEGPINTNIIVQCPPGCAEYKTKVYGSDGVYSEKSSICKAALQVGVIST
NTGGMFNVALEGPKNSYEGSTKNEIESEKLSGIPTRSLRISTISKECPIDVISKGGNDLHQLSTATTLNQQAKQGQKLQN
PVKVSTPVIKTDLWEGKTNEPFISKILKEASQYIDESYGVDPSLSFATQEESKMAILEMRRKLKPAEMLTKSQSPKIMDV
VDNVDHIANELLKVTGVYKSITKELLDKLDDVEAIHSSQTGFQSFTLDTQKMPFEQTFSVYDMPRTQRGPSDWGYTTTAI
NGRTKLLGQNSPITGSSEHSPRGTFAQIKNRRFFDFTLTTEVYPPVSGIFGIAFRVRDLSNYYLLEFNQEEERIRLLRLK
EGITYILDTKEDFKFKEGEFQKVEITVQRDRIYAKIGHVKLQVVDEGLLSGTVAFYSNGVVGGVYFDNVSIKAKSCKKFF
MSPAPRSPRCSNYKQCYLSTFETTYDIVKNNDVNGNWEYIKEYKGRTNAMVVKTSGESRILLKETHTCKNGYFSFDFNPP
CSNGKVSGIFRYTDNDNYYQVIVSNTSTTLVKKTKAKTTLLKKVMFGFTQNEWNRILVNFEGTTIYVYSTKYNGNTKEII
KVTEKDTQVSHGRVGLSVKNCSETAFDKVSLEPFRVDSNKDVENSTDKEKTDSIYKSCTLNTHILQREQHCETMFGSNSQ
KSVTCTNNYCTECCDYYTNMITDRTYYNSCKSACSINDSYAENSTKEYINQLATCISGTSKAFDICTETDQKCKIEVCDL
CCNSAFDGVQKDIQGIVVKACQAQCSHRFDTDKVLA

Proteomics

Found in:

Not found in:

Gene-Specific Links for cgd7_1730

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins