ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

cgd6_5410 (CP2)

signal peptide plus thr stretch, charged repeats, likely mucin, a gene from Cryptosporidium parvum

Compiled localisation
apical during sporozoite
anterior vacuole and dense band during sporozoite invasion
cytoplasm proximal to amylopectin-like granules and periphery of amylopectin-like granules during early macrogametocyte
between pellicle and parasitophorous vacuole membrane and peripheral during immature oocyst
oocyst wall and parasitophorous vacuole membrane and plasma membrane during fully sporulated oocyst
during sporozoite and trophozoite
not residual body during empty oocyst
surrounding during mature type i meront

Who localised this protein by microscopy?

Chen, X. M., O'Hara, S. P., Huang, B. Q., Nelson, J. B., Lin, J. J., Zhu, G., Ward, H. D., LaRusso, N. F.
Apical organelle discharge by Cryptosporidium parvum is temperature, cytoskeleton, and intracellular calcium dependent and required for host cell invasion. (2004 Dec, Infect Immun) PubMed / full text
   more detail about this publication

apical during sporozoite, anterior vacuole and dense band during sporozoite invasion
  • "Both 4E9 (a monoclonal antibody which recognizes microneme-associated gp900 and gp40 proteins) and CP2 (an antibody against membranous structures) also showed strong staining in the apical region of control sporozoites (B1 and C1, arrowheads) or those that were maintained at 4°C for 2 h (B2 and C2, arrowheads), but not in sporozoites that were maintained at 37°C for 2 h (B3 and C3, arrows)."
  • Microscopy type: light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: Iowa
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apical during sporozoite, dense band and anterior vacuole during sporozoite internalization
  • Other genes localised in this publication: -

O'Hara, S. P., Yu, J. R., Lin, J. J.
A novel Cryptosporidium parvum antigen, CP2, preferentially associates with membranous structures. (2004 Mar, Parasitol Res) PubMed / full text
   more detail about this publication

cytoplasm proximal to amylopectin-like granules and periphery of amylopectin-like granules during early macrogametocyte, between pellicle and parasitophorous vacuole membrane and peripheral during immature oocyst, oocyst wall and parasitophorous vacuole membrane and plasma membrane during fully sporulated oocyst, during sporozoite and trophozoite, not residual body during empty oocyst, surrounding during mature type i meront
  • "A mature type I meront is shown in Fig. 10B. Again, few gold particles associate with the PVM in regions where the membrane is visible (arrows). Surprisingly, no gold particles were observed in the merozoites. Figure 11A–D illustrates the progression from an early macrogametocyte to a sporulated oocyst. Initially, gold particles are found in the amylopectin-like granules of an early macrogametocyte (Fig. 11A). Figure 11B shows that most electron-dense wall-forming bodies (arrowheads) are negative. Instead, the gold particles heavily decorate the periphery of amylopectin-like vesicles (arrows) and the cytoplasm proximal to these vesicles. An immature oocyst is shown in Fig. 11C. Again, the periphery of amylopectin-like granules and cytoplasm are labeled. Of note in this image is the localization of gold particle clusters at the periphery of the parasite subjacent to the parasitophorous vacuole (arrows) and between the parasite pellicle and PVM (arrowheads). An infection site harboring a fully sporulated oocyst is shown in Fig. 11D. Gold particles decorate the PVM and sporozoite membrane and the oocyst wall (Fig. 11E). Thus, CP2 was found, to some degree, on the PVM of all developmental stages examined."
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody to whole protein
  • Strain: Iowa
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Periphery of amylopectin-like granules and cytoplasm proximal to amylopectin-like granules during early macrogametocyte, periphery of parasite subjacent to the parasitophorous vacuole during immature oocyst, between pellicle and parasitophorous vacuole membrane during immature oocyst, PVM and membrane and oocyst wall during fully sporulated oocyst
  • Other genes localised in this publication: -
  • "Immunogold electron microscopy revealed that CP2 consistently localized to membranous structures throughout development."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody to whole protein
  • Strain: Iowa
  • Gene model mapping comments: blast from AY471868, annotation doesn't match
  • Localisation record: during sporozoite, not residual body during empty oocyst, varied during trophozoite, surrounding during mature type I meront,
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_100975

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>cgd6_5410 signal peptide plus thr stretch, charged repeats, likely mucin
MRVLLSLFLFAFLKAIYATDHRGSLTISSPCDGHLSFRLPLNHSFERSDIILSGKCLNGIIFTAMALDSGAIKGSVVPDS
SGTTVVTSGNPIYTVQTTATFEFLYRMIDPRIKDAPYKISLMKYTYSALSSQSKVKSVLVREHTSEECKFPQIDIEDSNL
CTLHLLLKKYSQNRSGSPNSKVDAILLAELEQSSSCFSGNSVQCTSELHVNKNSSDEDLANSFSCLFDESTECVPVESGI
QTEETGTQTEETGMTDAATQTIPIVTQTSTAKPLSKSELKKIEKLEKEKLKKEKKLLAKQEKERQRLQKLEEKERKKALK
EANKKSSSDKNEANDAKLLKKQEKEKQKRLREEEKEEQRRLKEQKRLEKEKKKQKLPKDNEKQKLSKEEKQRQKQLEKEE
RQRQKQLQKEEKQRQKLLKQEEKQRQKQLQKEEKQKQKLLKQQKKEASNNGLKDHVKPSNEGKEQKKQDKKKTKAEKELK
ENEEGESSSCSSKKKSKKTKTTQTQGPELVSVSTQTEDVIVLPVPREVEVTSDIEDNGYEYSNQIYHEDDIVIVNEVSDD
DSLNKVNEVYNPEVEVVSLSPSVTPVEYIPSSTSTTTTTTTTTTTTTTTTTTTTTTSTTTHGLKHTRYYKKSEDVRYTIG
PFASLVHKRDQDFKPTPSKQPKLPSKDVESRGFIVESKDLDRNAGTNSQGTIEEILEDAAKNGFITIVRDD

Proteomics

Found in:

Not found in:

Gene-Specific Links for cgd6_5410

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins