ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

cgd6_4970 (n60, Cpn60, Hsp60)

Hsp60; GroEL-like chaperone (ATpase), predicted mitochondrial, a gene from Cryptosporidium parvum

Compiled localisation
mitochondrion during extracellular sporozoite and oocyst and sporozoite and unexcysted sporozoite

Who localised this protein by microscopy?

Ctrnacta, V., Ault, J. G., Stejskal, F., Keithly, J. S.
Localization of pyruvate:NADP+ oxidoreductase in sporozoites of Cryptosporidium parvum. (2006 Jul-Aug, J Eukaryot Microbiol) PubMed / full text
   more detail about this publication

mitochondrion during sporozoite
  • "To define the distribution of CpPNO within the cytoplasm and organellar subcompartments of C. parvum sporozoites, ultrastructural and confocal immunofluorescence analyses were undertaken using C. parvum-specific polyclonal antibodies against the CpPFO (Fig. 5–7, 10–13), a cytosolic fatty acid phosphopantetheinyl transferase (CpPPTase) (Fig. 4, 7, 10) and the mitochondrial chaperone CpCpn60 (Fig. 12, 13)."
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: Iowa
  • Gene model mapping comments: inferred from another publication
  • Localisation record: mitochondrion during sporozoite
  • Other genes localised in this publication: pyruvate:ferredoxin oxidoreductase/NADPH-cytochrome P450 reductase PNO, phosphopantetheinyl transferase

Putignani, L., Tait, A., Smith, H. V., Horner, D., Tovar, J., Tetley, L., Wastling, J. M.
Characterization of a mitochondrion-like organelle in Cryptosporidium parvum. (2004 Jul, Parasitology) PubMed / full text
   more detail about this publication

mitochondrion during extracellular sporozoite and oocyst and unexcysted sporozoite
  • "Here we characterize a mitochondrion-like organelle in C. parvum by (i) ultrastructural and morphological description (ii) localization of heterologous mitochondrial chaperonin antibody probes"
  • Microscopy type: light, EM
  • Microscopy method: antibody to homologue
  • Strain: Iowa
  • Gene model mapping comments: blast from AF529276.1, annotation matches
  • Localisation record: Mitochondrion-like structure during free sporozoite and unexcysted sporozoite
  • Other genes localised in this publication: -
  • "C. parvum oocyst and free sporozoite cross-sections (A and C respectively) show a consistent compartmentalized labelling. In the free sporozoite the labelling is concentrated in an electron-dense region just beside the nuclear region in the same area in which the ultrastructure images indicate the double-membrane organelle presence (C)."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody to homologue
  • Strain: Iowa
  • Gene model mapping comments: inferred from another publication
  • Localisation record: mitochondrion during free sporozoite and oocyst
  • Other genes localised in this publication: -

Riordan, C. E., Ault, J. G., Langreth, S. G., Keithly, J. S.
Cryptosporidium parvum Cpn60 targets a relict organelle. (2003 Nov, Curr Genet) PubMed / full text
   more detail about this publication

mitochondrion during sporozoite
  • "Sequence and phylogenetic analyses indicated that CpCpn60 is a mitochondrial isotype and that antibodies against it localize to the rough endoplasmic reticulum-enveloped remnant organelle of C. parvum sporozoites. These data show this organelle is of mitochondrial origin."
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: KSU-1, Iowa
  • Gene model mapping comments: blast from AAC32614, annotation matches
  • Localisation record: Relict mitochondrian during sporozoite
  • Comment: a GFP tagged Cpn60 presequence was also assessed by light microscopy, but in yeast only
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10230

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>cgd6_4970 Hsp60; GroEL-like chaperone (ATpase), predicted mitochondrial
MLLRSGINLYKSVEGSIGLRSAAIRFGMRYISSGKELSFGGKARKEMLKGANDLADAVGVTLGPRGRNVVIEQGFGEAPK
ITKDGVTVAKAIQFGKGSVNLGAQLLKNVAISTNEEAGDGTTTATVLARAIFKSGCEKVDAGLNPMDLLRGIKLGVEHVV
NELDLLSQPVKSHDDILNVATISANGDSIVGSLIAQAYSKVGRHGTINIEEGNTTQSELEIVEGLKLDKGYISPYFITNQ
KYQKVELENPYILISQGKISSLKSILPILEFCISSRSPLLIIAEEIEGEALTALILNKLQLNLKVCAVKAPGFGDHRKQI
LEDISVSVGAKIIQEEFSNAKLDQMNSNQIQEFLGKCKSISVSKDETIITQGQGSPKDVKDTISLLKSQIEENQKLTDYD
KEKLRERLARLTGRVALIKIGGYSDTEISELKDRFIDALNATKCAIEQGIVPGGGSALLWASRNLGKLYSQSPPPGKTLT
PSQSSSNESNPIRNYDMAMGVKIVQDACKVPCHLISSNAGFDGSVIVGELVKVFSKGSKHFGFDAQTGQFVDMIESGILD
PTKVVKSGLRDAASIASLMTTTQVSVFEPSNQSEKNNSSGSNSSESSSSFGSLPGDFY

Proteomics

Found in:

Not found in:

Gene-Specific Links for cgd6_4970

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins