ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

cgd6_2330 (p30)

hypothetical protein with signal peptide, a gene from Cryptosporidium parvum

Compiled localisation
apical during sporozoite
intracellular during intracellular stages and sporozoite

Who localised this protein by microscopy?

Bhat, N., Joe, A., PereiraPerrin, M., Ward, H. D.
Cryptosporidium p30, a galactose/N-acetylgalactosamine-specific lectin, mediates infection in vitro. (2007 Nov 30, J Biol Chem) PubMed / full text
   more detail about this publication

apical during sporozoite, intracellular during intracellular stages and sporozoite
  • "p30 is localized to the apical region of sporozoites and is predominantly intracellular in both sporozoites and intracellular stages of the parasite."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody to whole protein
  • Strain: Iowa
  • Gene model mapping comments: blast from AY308041, annotation doesn't match
  • Localisation record: apical during sporozoite, intracellular during sporozoite and intracellular stages
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_75097

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>cgd6_2330 hypothetical protein with signal peptide
MSGARSSIFIACILYFISLVSANGVCILKKGASCLNASYSFIEGGMTPGDAIRVSVVLLPSASLELTNSSFQNIATLRFG
VDSCSIESGIASLRAYSLYKNGQYNTGSTISFDLVALEKSLAIFIAGSKVLEIPLLVAAPFMLTSDSNGSAPTLQFLEYS
TTETGFCSIASSGSCNNSSLVGMSNGVTKNLTIRAELPSSIPDDYFSFYISTYSNIYKLPVLEVAFTKQEWLATSSGSFV
GRGKIPAGINLGSSINFVLVPSSGGSVELKVNEKSLGVVKVDASSIKFIYQSVSQGTMNVSY

Proteomics

Found in:

Not found in:

Gene-Specific Links for cgd6_2330

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins