ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

cgd6_2210 ()

membrane-associated protein with 6 transmembrane domains possible apicomplexan conserved, duplicated adjacent gene, a gene from Cryptosporidium parvum

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_22409

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_133890 glideosome associated protein with multiple membrane spans 1, putative
  • PY04760 hypothetical protein
  • PVX_116685 hypothetical protein, conserved
  • PCHAS_134350 glideosome associated protein with multiple membrane spans 1, putative
  • PKH_122940 hypothetical protein, conserved in Apicomplexan species
  • TGME49_002510 hypothetical protein
  • NCLIV_022420 hypothetical protein
  • NCLIV_022430 hypothetical protein
  • cgd6_2210 membrane-associated protein with 6 transmembrane domains possible apicomplexan conserved, duplicated adjacent gene
  • Chro.60259 multi-pass transmembrane protein
  • CMU_007660 hypothetical protein, conserved
  • TA17740 hypothetical protein, conserved
  • BBOV_III001540 conserved hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>cgd6_2210 membrane-associated protein with 6 transmembrane domains possible apicomplexan conserved, duplicated adjacent gene
MYFTYVVRPGDAPEGRGPSQPLFFENFLVNNLKLGFGSMLLGFIGLTICSIFSGFGLHITKFLSPFNEATNSTGTALFFM
IFMIFGVICLNMSTILMDDDGSISQTRGFRSGCKAFGQGSLVILLGLILIVVTLYSNVGYYEGNALSGLDLNHVIKCMYN
AGLAITSVGLTILGFAAFLVEVYSSDGTREILGFASILLCKVSGIFMFLTIIFPDCKTIGSLATLVTIIALTHVTLWAGI
FESIALKSRIKMTQSAVRNEYYKSRNALAYFGPPVMAEGNYTQQPTM

Proteomics

Found in:

Not found in:

Gene-Specific Links for cgd6_2210

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins