ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

cgd6_2090 (COWP-190, COWP, COWP1)

CpCOWP1, oocyst wall protein with type I and type II cysteine-rich repeats, a gene from Cryptosporidium parvum

Compiled localisation
inner surface of the oocyst wall and oocyst wall during oocyst
cytoplasmic inclusion during early macrogamete
wall forming body during late macrogamete
vesicles during extracellular sporozoite

Who localised this protein by microscopy?

Chatterjee, A., Banerjee, S., Steffen, M., O'Connor, R. M., Ward, H. D., Robbins, P. W., Samuelson, J.
Evidence for mucin-like glycoproteins that tether sporozoites of Cryptosporidium parvum to the inner surface of the oocyst wall. (2010 Jan, Eukaryot Cell) PubMed / full text
   more detail about this publication

inner surface of the oocyst wall during oocyst, vesicles during extracellular sporozoite
  • "COWP1, which is present on the inner surface of the oocyst wall (stained red with MPA), is accessible to anti-COWP1 antibodies (green) only after oocyst walls are broken."
  • Microscopy type: Fixed light
  • Microscopy method: antibody
  • Strain: Iowa
  • Gene model mapping comments: inferred from another publication
  • Localisation record: inner surface of the oocyst wall during oocyst, vesicles during excysted sporozoites
  • Other genes localised in this publication: conserved hypothetical protein, cryptopsoridial mucin, large thr stretch, signal peptide sequence

Spano, F., Puri, C., Ranucci, L., Putignani, L., Crisanti, A.
Cloning of the entire COWP gene of Cryptosporidium parvum and ultrastructural localization of the protein during sexual parasite development. (1997 May, Parasitology) PubMed / full text
   more detail about this publication

cytoplasmic inclusion during early macrogamete, wall forming body during late macrogamete
  • "Electron microscopy localized COWP in a large cytoplasmic inclusion and in the wall-forming bodies of early and late macrogametes, respectively."
  • Microscopy type: EM
  • Microscopy method:
  • Strain:
  • Gene model mapping comments: annotation matches
  • Localisation record: cytoplasmic inclusion during early macrogamete, wall forming bodies during late macrogamete
  • Comment: strain information not found
  • Comment: localisation method not found
  • Other genes localised in this publication: -

Ranucci, L., Muller, H. M., La Rosa, G., Reckmann, I., Morales, M. A., Spano, F., Pozio, E., Crisanti, A.
Characterization and immunolocalization of a Cryptosporidium protein containing repeated amino acid motifs. (1993 Jun, Infect Immun) PubMed / full text
   more detail about this publication

oocyst wall during oocyst
  • "Moreover, confocal microscopy analysis with immunofluorescence indicated that the protein was localized on the oocyst wall as a uniform stain and within the oocyst itself as bright granules in close association with the residual body."
  • Microscopy type: confocal light
  • Microscopy method: antibody to first 786 amino acids
  • Strain:
  • Gene model mapping comments: Blast from Z22537, annotation matches
  • Localisation record: oocyst wall during oocyst
  • Comment: strain information not found
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_23779

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>cgd6_2090 CpCOWP1, oocyst wall protein with type I and type II cysteine-rich repeats
IVFSFIMKRILLLSFIIGAFGAPQVKPNIPGVASPLPHTKGQVPTYVETPLESCPPGYLMENGVCVQRIQVPPMPFCQEP
AIYHEGHCLIVTAPLKQCPPGYEISGKQCTATKTASQQPSCPPGTTLHGTECISKHMIDTVCPPGFVDNGRDCVAFTMPE
KSCPPGFVFSGKQCVQSDTAPPNPECPPGTILENGTCKLIQQIDTVCPSGFVEEGNRCVQYLPANKICPPGFNLSGQQCM
APESAELESTCPPNSIFENGKCKVIKNIDMVCPPGYTDSGDDCVLYVAPAKECPPNFILQGLQCIQTSSAPTQPVCPPGT
VLQDNACISVQAIDAICPPEFLDNGKDCVKYSPVTKECPPGFTLSGNRCVQMVNAPMEFECPPGTILKDDQCQSIERVDT
ICPPGFVDNGEDCVQFSAPEKICPQGFSLSGKQCVKTESAPRLTECPPGTTLENNSCISYELEDAICPPGYLDNGSDCVQ
FSQPEKECPTGFVLIGKQCTQTTQAPPQPECPPGTNLVNGQCQKVERINMVCPTGFIDNGTNCASFSAPNRECPPGYTLS
GSQCEQIKEAPPVSECPPGYKLQGNQCTALKMIDAICPDGFLPNGDDCIQFSPASTVCPTGFTLQNQQCVQTTTSPKTPE
CPPGSALDGDSCTRLVPGALQYVCPVGTREGDVCVERSISSPVLECPPGYSLETGKQCVRRSQYDCSVTTYVTECKTPDV
KALRRLAAAKETSTVYETSEIQNPGHHHGHSHGHSHSQVIPIQTQNIHTQHHKEAPRPICEDVPKITPKTCTKADSVPAV
PICENNAELVGKECVLTNYYPLEAICQDGTRSKECAKFVKTPPTLKCPPGSVDVGSQCQVNKYSPYDLACPAGYALVGDK
CATTREKVCPNESCQRVVTAPVSLTCPPGYHQIDEVMNISAHPHHRHLAGVQSTSQKGYSHGHKYTPVISQPPQPVPVVA
PIQQMKCIHADHAPYNLICPVGSRLVADKCVTYSDKICPNGNCERIYNEPAELVCPPGFSSSKPIQPISHSHINHPNVSV
PVQPQTINQPQVIQQRQVNYQPQVIHQTQEILTTYPTPVYQTGTIYQGHHHHHHHHHRNLASPECIKTISVPYILKCESP
FILDGDKCIEKTEKICLQGDCRKQVVVPPTLSCPQGYRNANGIQTAISSKHTAGTHHYSTPSAECVRTIFEEYSLVCSSG
FVLLGDRCALFTNKICPNGNCERLISKPANMVCPPGFTRPQSNHHSDHAGHGHGHGNQLLQECTKQIYTPYDLSCPDNYS
IIGDKCAIHTVKVCPDGNCEQLIRSPPTMECPPGYYRPQAGVAIRSHGHKASGASQCMRNVYEPYALQCPDGFRLLGDMC
QQSTAKVCPNNNCERISYIPPILSCPQNFERSGQRCIANEYADYELACPPGLIVISDKCAKYADKVCPNGDCERIRTFPP
ELVCPPGYTMEAGVAQGTRRSLGTASNHPHHSSGHHHALGHHHHHHAVTQEVSIVRTTVCSREVFAPYSLSCTADSQLLG
DRCARFAPKVCPSGGCEKIESTPVVSSCPSGYVTDQDGTCYIVEYAPFSLTCNDPYTLFDNKECVLVTKPDSRCPDNTEK
TSTGCVKKVITTPIVSYETTCIGPTCNAA

Proteomics

Found in:

Not found in:

Gene-Specific Links for cgd6_2090

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins