ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

cgd5_4080 ()

articulin family protein, a gene from Cryptosporidium parvum

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_20687

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>cgd5_4080 articulin family protein
MNSCNSLGLCSAESESPILQHNYDSVDTNGNTSFGRTNMSRRDDFCCMSDRNVEDNENDSFIPQDCCSSNPRIVEDSNQD
SVSSPGGNAQIVTVPLVQEVNVRDRIIEVPEVHITQKIRQKVIVKDVIRKVPKQEIQYVDKFVEVPEVRIVDKFVSKPVT
KYVERHVPKVEVREIVKEIPKIEIQYVEKIVEVPEIRVVDKIVEIPTIKHVIKEVPKIEIKEIQVEKIVKVPKIEIKQIE
KERKVLGPVEYIDIPIEKIILKPNPQIIEKIVQVPIPKEVEIEVPVYNPDIRDTVEIEVDNYYTVEKEVEVPIPGRIIPV
PVEVEVEKIVEVPVQVPQEHIRIVQKQVPQYIEHIRTVEIPQYQDEFVEVPQYVPMVHHTIIKPVVSQEYKELPPVVEQG
DVRYVKEPPQYLETEYIHGEPIELDCNTPLPAPPSPRYTTIKVNSANNRDS

Proteomics

Found in:

Not found in:

Gene-Specific Links for cgd5_4080

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins