ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

cgd4_2900 (PKS1)

polyketide synthase, a gene from Cryptosporidium parvum

Compiled localisation
cytosol during sporozoite

Who localised this protein by microscopy?

Zhu, G., LaGier, M. J., Stejskal, F., Millership, J. J., Cai, X., Keithly, J. S.
Cryptosporidium parvum: the first protist known to encode a putative polyketide synthase. (2002 Sep 18, Gene) PubMed / full text
   more detail about this publication

cytosol during sporozoite
  • "Like CpFAS1 protein (Zhu et al., 2000c), the CpPKS1 protein appears to be cytosolic. However, CpPKS1 seems to be distributed more along the anterior half of the sporozoites ( Fig. 6D)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody to CKHENSIEFNDKDCMKRNLVC
  • Strain: KSU-1
  • Gene model mapping comments: blast from AAN60755.1, annotation matches
  • Localisation record: cytosol during sporozoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10117

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>cgd4_2900 polyketide synthase
MNSSKPEYDAIISQIELFSNTIPDSNAFVWLNDNGNEESTITYKNLWKSIRIISHFLLNELSLKKGDRIILCYTPGIDFI
YSFYGCLASGIVAIPVYPADPNNSSQVDRLRKIVDISQANACLTNSSYNRIISLFKFKFFNEPLWNAISWYSTDKILRDY
SEFELVTDNGFYKSKNDSLNPFKTVVKNEIIHFKKPKCEPHDSAFIQFTSGSTGHPKGVIVTHGSLYYNSLLCMKCFNFS
LEPKFESPETKITENDIETSDEANKILKEIIEIKNQFIKTFGHNIRGFSWLPMYHDMGLVGFIVSTVIIGSETFLLSPFS
FIKNPHIWLKVISKYRIAATAAPNFAFDYICRKITNDELEEINNLGGLGCLKHGGILSGSEPIRAATLVRFVKKFSSVGF
CSSAFLPAYGMAENTLIISGLKKKSKLFPKVLTLKSDKIIPGKKVEIVNYGYISCYCNYCKHENSIEFNDKDCMKRNLVC
CGEKNSVNDKIIIVCPEKNTILPENYVGEIWVSSRSKGAGYWLLHDLTDKIFFAKVKECDSDLSDIKFLKTGDLGFINND
QLYIVGRQKDVIIIRGKNYYPQDIEEVIDTCHEVIRPGCCVAFSIDIDGEEKLAIATEVRSELIESSDILGIKSYIKGLI
NKKERFQAKDIIDKLSISIQKYLGIEVYRIILIKEKKMPKTSSGKVQRSKVKQMIMNGDFGSSIVIDFINNNLENIKLVE
VFDKDERNIDSDYFSVYSENEFPDKIYERVKHIFESVVGNKYFPELDDPLLSCGIESIKAVEICNALSKEFNIDFPATLI
FDFPTLRLLIEHIDLLKNGNKEYLPNEITSVPGKTTSEFVISGINAHLPGFSSNNPFVKLWEVMMNSANVFSPVPHERWN
AYCFNEKKSISAIQKIKNYYTDTGAYIIGSEFFDLEKFKILPIEVEHMDPQQRLLLRGTEKILKHVELPTNNSTGVYIGC
CSNDWSQIISNSTHLSVYSGTGASPSILANRISFYNGFAGPSITIDTACSSSLVALDIALHHLQQNITNTAFVAGVNSIL
NPNIFVSLCKAKMLSDTGKCSPFDESANGFVRGEGCIIVCIQHISIAKKKIATILGTYVNQDGKTTTLTAPKGPSQVSAI
RNCLGISGMHPSEINYIECHGTGTPLGDPIEAGAIMSVFKTHNEYQYNVTHMNSNIVIGAFKSNIGHLEGAAGLAGLLKV
LLVMSRRFFPGIGNLININTHIKKLLNDKTNHNRIIFPNMNEGKYFSEIGIEETQVLRSGISSFGFGGTNSHVIIEEGAN
INSIWDIETEENSDLQEGNYFPWTARFHPFISTINNKDEIYSYAISKLKCKKYVIEHIINGLSIFPASGYIELAIITCRL
AALDISSGEQIVYIQKKNSRDEIISEFKKSNFDILTRESNIYLLKTSPVVIKNLEIISVFNLDNLENEELNANIHINEGK
VSIYSKNRDYFSCNANLILDIESNNRMEILDNSFTVDEFKKVCILRTIVHDELYDLLNNSGYNYIGRYRSLEYVSIGDSI
GYGKIKTDEYDSSPFCIAPWILDSAFQVLGGFLITNGNINGQFIPVRIEEMLINSDISYSELYSLVKITNIEEKQIICNI
CLINEKGSKLIEIVKMNFIKNEIPNQKTVVNLDHKKKIDHLNSKVDYENNYFGIKLDWRPVAASELFENNDNVNSYSIIT
SDKQFSRINSSLEKTGNKIIKFNKNLINFDGNIVFFNCKLEEIKISIKQAKSGARFYILTKNAIPIEKIIRTDGFSFDNL
YWDSINQFILENNIIISVIDIESFDELNSQIKFGINYLGKNNIKNKIPNILFDHLVIRNVQMARERNLTLIGYSATPIRI
GNCIGIDNFKYELTSRGELKNFKIKYSEKFKIEELGDDEVKVQVKAVGLNFRDILNIMNLYPGDPGEPGSDFSGIIIGIG
NNVKPFKIGDHVWGFARGCFKSQLVTTSTLISKKPRNLSFEEAAALPVIFCTVEASFNDLYKVKKGDFVLIHAATGGVGI
ASVQYCINKGAIVFATCSSNSKKKWLCGLGVHYVSSSRDHKIFNKEMNEFLNIASKRYRGGKNAKFDLVLNCLSGEFIHE
SFKKIRSGGTFIELGKRETLDYSQAKSNYPEINYLKLAIDELVVGNAKYIQSLLSRYETNNLINTNPTLPVKVFKMESCT
LEALRFMQKASHIGKIVLTLPPPQTLMFEAFNYKTLNIVNLEKFSIELFKRYECSELVDLLDQESRNFELYKDCESKFIN
EMITKGNIIGPFEIFSKYKNMLESLFSASQSIPLKVINYIIDNEIFEELRILIISPIFPEILLDKILSFKSGKVVFLTIY
DENNKERCYKVGNNIVNYVSSIINLNSEQFDFAIITSTFFGKLSFISLMENIKLMLKKGGPLFIINPFGEGLTSSIIKQQ
YCSYTSKIIVPIKFRVDFNVENVIDEFKLINCDKNKTVKFYSFETNYWDSEFVKQNNTDDNGFKNNFHIILSHKEDEISL
FAATKLLSEAGANNFVYISTEKITINYPFKYKFEIEKENFVQNFKRILSGNGIYKISGIICLPLNHLECKEISNILWDIH
SISFISTTSIQYFLLCSCNDKNNLILETFCRYRRNIGLPGQVAFWNYNSEQVSNLNHGSFVQAAIKLAIVSNSACIYKPM
KNQVENSEAWETNSKIVFDKQHITNIIVNTINDIVGIEKIDFNTPLIELGLDSLSAVEVRNAISNELNIVLPITTLFDYP
TINSLSDFILNISNTSTNILLPKTNKDNIGLIISQNIPSLKNIIFSQDNKSKNLTSKLSITGIGCRLPGNTNSPIEFWER
TLLSMQTWSSEVPLSRFDIDEFYLNIDDYKNINYLSKNLTYSRHGTFIESIDLFDNDYFNITTYESSTMDPQQRILLETT
SDALHSSGYNPKNISNSNIGVFVGCCGTDWNYLSTKLNMTATSFTATGAAASIISNRLSFIYGIKGPSVTIDTACSSSLV
ALDIAKKDINFGNIETAIVAGVQLLLSPLYYIVFSKANMLSPRGECRAFDELSDGFLRGEGCISLIIENHLKSFGKKIYG
RICGTAVNQDGKSASLTAPNGPSQKRVIINAIEDSCISNNDIFYIESHGTGTPLGDPIEFGAISDVFKNRANKLYIGTLK
PNIGHLEGASGVAGILKAILVVNNGVIPPNILINKLNSGLCFDDSNMNIVFPTNKVETNSKSLIAGVSSFGFGGTNSHII
VETGDSVNSWELPRIDFKRKKFPWITPAHPYIGPKISGSDNLSHPSELGLIIDEMSNITNIKKPDSNITRFVRNVGENVF
SSIVGHVIQGKIIFPGSAFIEMSIGGLINYSIRSGIKDVSLLTISNIQFIKPLIFPNELGRNPQGKLICDISPYENNNRK
LNIRISTSGIEYGIDEMIYHSTFTAEISNDDNLKLSDETINFDKCSNFNSDQFYSELNEIGLNYSEKYKSIRKIYKNKTE
IFGIIEIDSLNREIDTFFLHPSLLDGCFQLFALFIENHENKANKPFIPVSIEEMIFKPIFNNNKYIVPYNSLTNLKFIHP
INRLFACIKNKKILNSEGIKVDINIYIRDEGTDGLIQICEIRNLHFRELIPMKTINYLPIKDHYSWISTYRELEHKFDND
EELNKLKFLFTSLEVNKLSLEQFDYFDNNKILNLIQENIFSFSTIPVYITSTNEKDSYKELISIQRTLQNIYKNIDSYNK
LTIIFVTIGANLLCGKNTLSSHFQSSLLSYLRSASNEFNQLGKISLIIVDWNSISNLKINKNFCQILKLIYNNVINKKWF
EKEYQLLEYNNEIKIKTIKIKESISPYNNYMALKLTNRGAISNIITNLQKFRVVPMEGEVEIRIRAIGLNFRDVLNVMGL
YPGDPGKPGSDFSGTVVSVGPGVKNIQVGDDVFGLSQGCIETYHTTNALLVAKKPKLLTFEEAASIPTIFSTVKVSLNQY
SKLKKGDCVLIHVASGGVGLAAIQICSRIGANIIATVGSIKKVEYLKSIGIKFVSSSRDYTKFSQDMKYFMSELNIDGVD
IVINSLVGEFIPLSMKFLKRNGTFIELGKREILSENQLKEIRTDINYQTVEFDKLVENDIVWFQNLLQEIMIDINKGKIQ
PIPTKVFSIQDKSGIIDGFRYIQHASHIGKVILSNPSTSICSYSKDAYIITGGMGSLGLVVANWLVEEGTKNIILMGRSS
IDFENKFAIKLLELSEKGKINLEMLKCNICDLNSLFNIINKIKGKYNIRAIIHAAGVLNDGSILSQTDSTFLSTFLPKSI
GAWNIHYITTSLLEHIPLLIMFSSISALIGNNGQTNYSAANGNIDYLSEIRSQLGMKSISIQWGPWGEQGMAKENLNLKM
LKAIGLVPIKNSLGLISLGGIISNCMINKVNKYIVQPLDPLVVKNNALTHIFSEIESEVQETRNGYLFSTMNSEELHLFV
LSSIKEAISDAIGIDVNLIDSELPFKDLGIDSLSAVELRNTLTSKFEVNLPPTIIIDYPTISELCKYIEMIIGKKNVKEF
DNKNIIHSNFKKSDIFISGIGIRVPGDASSVFKFWKNMTSLVTCISEIPYERWDVDKLFGDYNDKNATYYTRKGGFISIV
DIFDYSKYQISKEEAIQMDPNQRIALDTCFSALSDAEIEIKDLFNTNVGVFAGMCNDEWAILSSKRNYCNAFSGTGNAKS
IISNRISYVFGLKGPSITIDAACASSLIAIDQAIKSLKNNECNMAIAFGVQLNLSPNNFIVFSKAKMLSKNSECRSFDKD
ADGFVRGEGCGAIVLSNNNIKIKKKWGRILGSSTNHSGRSISLTAPNGVAQQKVLSTALNIAREENKSDIRPGYIECHGT
GTLLGDAVEFGAIKEVYKDMYKIIDSNIDSPLILSTVKPQIGHLEGAAGIVGFIRLLVVLSFGAVPALLNYKNINPHIEV
EDFNIVFPNNSTWKLNKNVGGVSSFGFGGANCHILVEGVKQKNPLIKDNEKLIFMFTGQGSHYDKMGIEYYNSNEIFRKS
IDECSDFLDKFLDIPLKEAMFIEGAKEKINIDVEIYNQLSIVSIEYAEMMLLRSIGIFPDIIFGHSLGEYLVAVAAGVMT
IEIALEIIYRRGIVISKFGKKGIMVAVRRSEEQIKKAIKQFENSLSQEQKLKISLGLINAPKNCIISGEENQVMAVLELL
DSSKSYKKLPVSYAFHSVMFSEISNILHEEIKNKNLNYIDKKVIVFSSILGLMVKDEMSNLNYWSSQLFKPVNFYSMIKN
LEEFIIKNEIKVKNIIEIGPTSLLTPLLKASSKGILNNAKFYSLMKKDSNVNPTEVLENICSNVNIKIANRSSNENNLPK
IDYHLKWNEISHPFLLKRMLSPIINLNKIVKDLSFVYATPLTEKISKFFHGYKRNGAFVMPEIALIEVISAAINDINSQI
SMIDNGFLSVESNVPIFQLEKIHFGIPWEFRTYKTQDDRPTLIFTLDSRRNISISSNKGGHINADLKKNSIHHLDAKLNV
YFPENKRESIKFPIHALENSEALLFEEIYGPIIKGSFPVINSSKCIRKIVLKENESFSILKLNFDMETDLEPSGINMGLF
YSIDRFMNVHPMILESSIHTIMLAAIKNNKHFDLYFPTKIDLLNISSIDFTRNVYVHSVIREQNEEYILGDILIYHENQF
DFPIVEIRKIRLEKLNFENKIPLLLNQEYAFLKEEWELQNNNEQNHYDKIIIFGCSKTFDLFKKNLAQNIYFVENEKDLL
TYLNSISSSKILIINTFFRSGTKFEVISNEIELIKEIIISNDNFQKKQNNFITWWIVTKGVVLFRNNQSINNSIWKKIKE
IKEKMRDYCRVFMTDTDDIYSINNIISYQKTDECCYRNGAIYFLTLNCKQLINHRVFDLRKNKNLSIEIIMVENIINESF
KFLGKVVYSCNTNILGQYVIIENNNDIQHEIKIGDLVITEVDNKYLIGIDDYNYFGLRSNVALPKIQYIFDKIPFNLFEN
IVIKISNKNKLVKIYEICFSIIINVLKLNSVNKSRKITVIGNYDEKFSKIILSLGCKLNIDNLSKPDCLIQIGEETKLFN
INQDPIAKFRIGINHEVINECNNETILNPNYQESNQLKLELSNPYLNKTEKINFVNKFGLILITGEMKNITLIINCLFAL
GYKKIALVKMDNNALSEKISEFGESIKLFNCLPNKVSINNCFNKIISEYQNLEITGYIHLSSIEILKTDQEKVNNYSLIP
WNIHNLVTKKGYNLTFFVIISGIFGQLDQLKFGIAENLFENLTYHRNELLKLPSTYILDNKIVNYIGGNKSSLFSIENYI
NKIPLFTNLFSEIINSKLNGTIVPIEIDEEVINQLSKNSTEKSKKLYFKFVEKISRKNFNNIKYVKFSNNLSKRKKLIEE
MVLKSVNSLIPENKKYSMDDSLLSIGISSLSAIELVNKLSSEFNYEISPSLLYEHPSINSIINYLLSLSHHFDENIEYFD
DKINSEIIEKNTLLNINNYFINPEILVSSVNNDLDLNSRMCIVGMANNIPVAGASVGLFWHLLKENKDFVIEAPINRIDW
GDSLNTDQSIIGKSYCNHGTFIENAHLFDNEFFKINEYEVLQMDPQQRLILEVCFDALHVSGYKNLNEMTNLNFGVFIGS
CTNDWLEKLSDLDSINAYSGTGFSSSLISNRVSYSFGLTGPSLTIDTACSSSLVSLNIAVQNIEKKQCNGAVVAGVQMTL
NKTTFIVFSKSMMLSKDGRCKSFDYSADGFGIGEGVAAIVILPKKECERKNKKVLAYISGSSVNQDGKSATLTAPSKNSQ
VKCINLALSSMEHIHPSMVTIVEAHGTGTLIGDSIEVSALYEAYCSSERKSKLMIGSGKSNFAHTFAASGIIGLIKLVLS
LHNSMIIGNIHLKQLNPYIVHYEKLIIPKINTLIPIESEVAFGSVSSFGFGGTNSHVIVGVEKSDFDIISYIQKSKFNNF
KRKSFEWKNFPIYDSNKPIIVYTKNSSGIFEKCDSILLNNFNPNIENIFREFFNLANKLQNNNEFGVRITRFRHYGREKN
DLYLLTYENCKDKYHVSLWSIEYKLIREKEIFLDIFSRGISIISECIVEKDYRFEYYLLEQNIDIKKDNLAISLDNTNVN
DIIQEKLSITSSNNIIDQILNRISEFIDINYYSISEVISFVNILDFLNSKNIELLYQVNTKSKNNKVPIRLYSQYLQEQL
IEDVYSVKKSWRCILEINLLQQPPVINPFSNLLETASRKIPGSKEIEIIINAFSITECFGEKIFGISGTIVSKGNEVSDW
KIGDNIIGIVESKINQFITTSNLVFRKPSFLSHEESALLLLHSPVTEEIIRRISELKRQNCILIFSKLNGVFLTVINYLL
YSELNFTVVISEKNVYNFLLSIGVKKIVMKDNIDIIKSSTDNSYPDLLITDEVLNLDLINIMDNNGKIISINSKNINYWN
EIERKNITYENISIIDILSKKNMDQNFDINRLKKENIFNFPILIQEYNFDNLMINNCKNYNYLGEIVYSLRSNLSENIFS
FSKELFTSFKNNEMNASRHNLRNFIINKLLNNYSNTIIIDGDYFSIEDAWEIYYLITFIQLSFREIFIIFSQNNKNIEYK
YLAKKIIENGFKAMIELKNFDQIDKFNSINIPIFIDFKLGGFNRLLNNDLVCSKKENGSIKFNIISERIKNIILNIIKID
SKNPIEEKKLFDTPIRELGVDSLEITELRSILSKEFEIKLPISVLFDYPTLNELIGYIENNSSKEIKINKTDLKINFDGM
KKFNIGIIGASCTLPTGIDNLSSFWESLMLGKCGVNLIPYSRWNCELENDSITKNISTILGLELFDNNLFGISNIEARTM
DPQQKHLLNSTFNALVSSGNSIESIKNTDTGVFVGLCNIDWSLYLLNERSCNSAYIGTGTASSIASNRLSYFYGIKGPSI
TIDTACSSSLVAIDAAFKNISLGICEMAIVSGSQLITTPNLFSVFSRANMLSKDGLCKSFDESADGFGRGEGVATIILKK
FNFKNESNRAVLGILKGTAVNQDGRTASLTAPSSKSQSDVISHALLRSEVQFNEVSMIESHGTGTQLGDPIEIDAIKTVY
QLSSKKLVIGALKTNIGHLEASAGIAGLIKLLLSLRNGISPPNLHLKNLNKYINVDNTNIVFPSSKTRLSISSDESFIGG
VSSFGFGGTNAHAILEVSSANKIPMINDMAIAILNEEFENEYTMNITHLTQLRELIANNTIFESYFRYCTMIILQILNIN
FYEIIIENNEKLLRAEEMYILLFAFYYSIYQTLKYCKIVVDTFISDEFGSILFDTITNKIKLPNAIELLKEYCNKKLYSM
NSNLKIYCLNEKENHPFKLEEVKFLNASVVIINPFTFNNKQKKQLRNMSKLIIHNESNYLQFIENVINNFGKMSKVSKIE
RFPLNNYIHPLLDSDIDSSYNIEISKFFIERYCDPSYENETIHQGSIIIISLLFESLISILNKKHNLSLEFKIESIEGIY
ETANRVRKFDKYSKLKLMKNKDHFILCAFNGLPLSSLSIKESLERKPQVYIPEIESPKYNEFKKTKIPKNILKLISSIEV
HESSIYIKLKLPFFNLSVESIFCIHPAIFTLMIYSSMEILSKKIDPLKITIEKLSNIIISDVFDIEKICCNSRYTLELVC
KINEGKNININLWVADDYGIQPTELFLQCDVIFTENKVNIINSSTGLVWNTIWKEIKYNLISEQKQGNKLIINFNKNTII
SRKDLMVNDIFMNYSQFLEDNFDLKDINNIIVDMCIPIPNNCQMKEIDQSYFVISENWEIDFIQTFKKIINKNNRNESIN
IFILVNNTVKTVENDQINMNMTWVWGFMRSLRMELSSKVKILLIDIDINQLEEKSCLNTEQSIQVTNIVSNVKSLDEDGE
YEFVIRENKIFVPRLKQYEFGNHIREKSQTDLEICNIITGGLGGIGLAIAEWLIEVVGMKNILLLSRNPHMSTKKSKKWK
QLTEKTKENILIEKCDISNSAEIVTIIEKYSKIYKKIGVMHIAGSLIDSNIHNLTDNIVSDVNLPKIRGIINLHNATLNK
NCEYFIAFSSITSLIGNIGQSAYAAANSVLDSIIEFRRKLGMPGNSLQWGAWAEQGMAAENELLQKNLVNVGLSLINNNI
AFEIIKYIISDSNKFPSVLAIQPANWDKFIDKIGIRYGILKEITSNKINHDRITILNSISAENRIDFISNKIISICSEVL
GIENDLNSEQSLMDFGIDSIMAVEIRNSLCDNFGISLSHTILFDYPTISSLSTYINQKFMSNCKIEKSQEQMNLKENLFD
YNVAVIGAACRLPKNITNLSGLWELLMESNCSVGKIPYNRWDSGLFFSENINSGKMYTESASFIDGIEFFDNSEFKISSS
EVYYIDPQQRIIMETALLAIKSSNVKLETLVNSLTGVFIGCSSSDWTILTNTASVPPGPYTGTGISSSILSNRISYIFGF
QGPSFTIDSACSSSLVALDSAFEKFKNNNIQFAIVGGVNLLLSPQPFLACCAANMLSFDGICRSFDEKANGYGRGEGSIS
LLLTYLSKAKENNEKILGIIKSTSVNQDGKSATITAPNGPSQQFVIKHAIEKANLSPSNITYIETHGTGTKLGDPIEYNA
IKSVFNLEDNTFDNNVCLLRYSPLYLGAIKANIGHLEGAAGIAGLIKLILVLNYKVAVPIPNLRKVNPLIELNNFNAIFP
MDKKPVNIKNDSNIIYGGISSFGFGGTNAHVIIECNSDNITENSILFRSENFSLRRKNYAWSDTKHPLIDEKILENIGNK
NSELNGIKLFRNINHKIFSSVKFALKVNNDIINMLSDHVIDNKIIWPAAAFIEMILGVARNIYICNNEQISFSKRILKTN
IRNLLFEQPLILEKNEENILVCDFDLRLKRIKIYSELTYESNNELIYVSSEIGNTDKIEMINEGCLINDLEISKEKELDI
SLIYNRLMELGIQYGKKFKTIKKAWKLKSENEALTKIQLNSDEYIIKSDDLSAQEPFLSLTELGFGIHPALLDGALQSSF
ICISEIKNDLEKIIWVPFSISEIEYYNNQEPILEAWVHCKVSPTNNKNEVISDIKIYSVNKDLLFNIKNIRYRSTIDISN
KIIKDSKENNPENIKNCWGLTWKKSNNILDKIEKKRWMIYLGDEIEKKSSLNNLFKYYWNKNDILEELSDFSGEINIAFV
INSGINNKLHNHGIEIVNWLKHLFDINSKVSRSSVILFITENTIPHNNNNHKFIGSDIWGLVRSARYELDKYSLRLLDLD
CFTKDLSEDNLSKIFSCILSSNESEFIFRNGELLFPRLSKISIPINGPLNIRLAERGALTNLLTEMQTNIPYINSDKKLD
LIDCFDKLENYSEMKNEPILKDNEVLLRICSVGLNFRDVLNVMGLYPGDPGPPCSDCSGIVVSVGKGVKHLKCGDEVYAM
VPGCLNTFIVAIGDTCCLMPKNCDFSLSSSIPTIYSTVDICLRKIYNIKKGDRVLIHAASGGVGLVAVNYCNSIGAKVFA
TVGNSKKEKYLRHLGVKNISTSRNSELFKLEMECLLKGEKLDVVINCLSGKYIEYSLELLSNNGIFIELGKINILSKKDV
SLIKPGIRYEIVALDDLILNDPSWFGTVLVDIKTRIEECKESVIPLIEFSMENHKDSNDLIEKSGCISGFRFMQKANHIG
KVVIKNPTLDNSLSRKNGAVIVIGGNGSLGKFTTKWLYFNGLKNIILLSRSSNNYASNLPGVKQISCDISNINSTISAIN
TVLENPESKPIVGIIHAAGVLDDRKLFEHSKESFKCVYSPKVQGLWNIHQITQYLYIELEFLIAYSSIASLLGNIGQANY
SAANSFIDSFMSYRSSLGINSFSIQWGPWLGEGMASNNLSLKFESTGLIGVDKLTAMQALNTIIKSKKKSIPNVICVVDA
DWGKLVSNIPPKTSNIFTDIINKKIIEKDYNKSKIMELLEKKSSVEMEDYIINLLRDIIKTVVTDDKIDINDSKLLEKPL
HEFGIDSLSAVEFRNILSKHTGILLPTTLMFDYPTIINIKDYILSEMEDIRLGDKSCDPLVTDIKKDRILDIAIIGLSCK
LPGSTEDIESFWEILTGGINCVSNVPVVRWDHKKYFSLNLENFGPYYYANYGSFIDNIDIFDAHYFGISPSEATIIDPQQ
RLSLMLAVQSIEDAKLNLSKLKGTKTGVYVGCGNSDWALMQGNQISESEYISPYTGTSVALSLISNRISYNLGLNGPSMT
VDTACSSSLVALDIAVQNLRWKKSDISIVIGVNLLISPQAYIVFSKSKMLSITGSCKTFDKDADGYVRGEGCCSMVLCRF
DERENVDFDKKTLKAEQNIIIYGFIKGSAVNQDGRSASLTAPNGPAQQKVIKSAIEDSYIKLDEISIIEAHGTGTQLGDP
IEFGAIKNVFNSRNRGPIYITALKTNIGHLEGASGIAGVIKMILMLNHSIVPKNLHFKTLNPLIDNSNFNAIIPDRKLKV
SANIGGVSSFGFGGTNAHVIIEKNISKIPLENQNYSIIENTNKEVSNKIAFIFTGQGSQFENMGQELFENEPIFRKSMLE
CAKHANEYLPESLIEILYPEISTPRTKAGSKDAGFYDINDILYSQVAIFSVEYSLTKLLESKGIIPDLVIGHSLGEYCAA
VIVGAIELNQALKMIINRSKILEKSNISDGGMLALRKSASSIAEILKEFDENNVSLAAVNGPNSVVISGRKYILKSILER
LGGSGKFLNIDNAFHSSLMQDASNKYKDFIEEEIVFCNENKKKIKFISTLKGRLINYSELMSSDYWSNHIVCPVLFYDAI
NHALNKFDCTILLEIGPQPILTKLSIQCIPRELKTKIKSFCAMLGKPSTEIEHFKLVTHQINQIFSPYMNTIRGNSEVSN
KNIFNNLRRFPWININSHPLVKLETDRKILLKNLNKMFDISKEGAIIELVNGGIREIFKNEIFNSMKMGRYYQCEIVLEN
LSFNIIEGNQEGWLEVEKKDINGFTINICSQNNLTYTLYAKIIFREDAEIELQEINIENSVISIEKFISIGLKENILFQK
IMNSIQELTIKLESKISFAKNTQKNSICLILTTDDYFKSLSKSFSGFSIHPFLLQLLFDFIKLYNIEEIIKGNSEINFYE
TIIRELLDSSISQKYLVFEVNNNSAIIKDKFGKILFKTSYSLVYLNSKNTGSVEYEIEQFSNLNNLDNLFWNTENQKIFE
VEMGIDEIEEDEYKCKRILIIGSNDLEDNLETKEETYYNVRSEFELIKNIKLKNWEKIIFVIDNFNVSEIELMHYAVITC
KECESDSNVWFIKINQSNDNSLESYNKGRGILGLCKTARIELRKMINYISIEKFEDLNTNAKLICNLVSLLSKNKSIPED
IFVNLYRKKIQVYTKIIKAQYSIQMKNNELNRDNELINGIVLISGGTGALGLIIAEWLIKCKNIRNIILLSRSGLPSKRC
ESIWERILILDSNIRIIKCDVANYDSVFSTLKYIISQAMESNSKIVGLIHASGVLNDSLIKNHSIENLENVFRPKVFGAI
NLHYAIKNMLPYKLRFFIGFSSISSLFGSFGQYSYSSANSYLDSLINYRRKFKESSILDLSIQWGPWAEQGMAADLFQHH
SSSGIKPIYNSEGLKCLSSIFDIIEGRIEDIILPSEIAIANINWSEFLTIFEGNPPIIFSEISSKFLNNGSKLESGSKIK
DKFEGITDIRRHIEEVLLIIAYEIFGMEKNNCDLTEVDSLMAVEFRNSISKNFGIKLPISLMLDNPTLDEVISYLEGEVR
KELFGSSTEELVSSKSRRWEEIRQDINLDGKISLLSNPSDAVRGFRLPSGEKNKLREVFLTGGTGFMGTCMIENLVKLNS
DIKIWCLVRCSDKKNGKEKLLDALYKYSIQNADLILKNNIKIVVGDTSIPYFGINKTEYKEIVNSIDSIIHIGAVVNFTS
SYSNIKNVNVLSIVELLNLSSAPNHCSKNCTEKGKCNSCIIPIHHVSTLGVFYDHIENPPVEPYLSGLENTEFMERTYFL
DDGRRIFYEDDPVITNDDEGTHHKSLLLGYSQSKWAAERILRSARKRGFPIAIYRPGRIGGNSITGASNISDLPNAFVKG
CIKMGTLPRTKMAIHLVSVDFCCQVCCFGMNNPSLSINNDFNLDSEGWANMNDIKAALKLLDIELEMVEFEDWVEQLLEE
TSKDRNHPLTPLQHMFVKEKPADSIMPYFDMKNTNNLISNSENIKHVPCDPNYLLTCFKYLLEKDWIYSIDSINKMMNKD
VCAKEYIFEFTNDELKVGNLEVANFMIFICDKLFILNIQEFCNKIQSKYNCKCIIVTIPNSKVDNILSSLSHIIHEAIKE
NISKIIDKGNSKIILASWSISSNLTLQIFKNLNYKILDCDIKLLLIDPVVPVKLSDSNDSRIDEISFKVLKKLVKSSSLL
SNSLTEPIIDILNNSDSIINVYNKITSYTKNDSKTEFEELKNVLERLRTTFLISLNISKSVLEVDEKVYFVLSRSSIMGD
VFEKNGSYAIVNAQNIYKIRDLELVHLSDGNHFTIFNFSNVESLVNGLSKIFN

Proteomics

Found in:

Not found in:

Gene-Specific Links for cgd4_2900

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins