ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

cgd4_2720 (ATPase1)

P-type ATpase involved in cation transport, a gene from Cryptosporidium parvum

Compiled localisation
apical and perinuclear during sporozoite

Who localised this protein by microscopy?

Zhu, G., Keithly, J. S.
Molecular analysis of a P-type ATPase from Cryptosporidium parvum. (1997 Dec 1, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apical and perinuclear during sporozoite
  • "This protein was used to produce rabbit antiserum and fluorescent labeling has localized the protein to the sporozoite apical and perinuclear regions."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: KSU-1
  • Gene model mapping comments: Blast from U65981, annotation matches
  • Localisation record: apical and perinuclear during sporozoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12462

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>cgd4_2720 P-type ATpase involved in cation transport
MIGSDDSFEPNIQNQTVQSSMATKSSNTFHSIFNKDEKLLEMSSQSSLKDVNSYSPNIATYNCIGNNSSPSSRIVSPISS
ASFFVDMTPNGRHLLHAEVADEEPNPETCSPNPQKFLQNRLNLLASRNLLNHYVNSNENNYFGKQLSSDVISSIPDLQYN
ETAVQDMVINKLSMSTQMLPDTIEEARKRDPEFVSKALEQTLEYSEAQKPIHYWSQIELDMLINELSANIIDGIDEGKAI
ELMEKKYGPNKLQKEKHEPIWRIFLSQFTSLVVSLLLVAGIVSLAFQEWVEGIGILFIVLINASLATYMENNASNALAKL
ADLSSPKCTVIRSGIINIIPAYNLIPGDIVLLRTGDSVPADVRLIEATEIKCNEALLTGESEDVSKHLVSPDPNNPFPTN
ICFASTAITNGTGKAIVVLTGMNTQIGRIAQQLKLASGGSNSGTPLQIGLNRLGGFIGFMSLIVLVIIVIVALLTNYKDP
SHPNSNPVFGIILVAVGFAVSSIPEGLPMVVTICLSIGCSEMCRRKANIRKLPAVETLGCCSVICSDKTGTLTEGKMTAV
KLATFSRNNTKTLNISPTGNEQSPSFVEYQESNSCVFSFYPTRGSDPNGGIFLSSSLTQNIKEEIMNLIHFNKNKTIEMT
ENHILESNFEMPPDDKIPYKFINYNSICKDFGDPLNSHLPQTKYVRSALLAGYLNSYGTALVYDNESNSWKTRGNMSEGA
IVVAAAKASYGIKNKIFDSRKQDIESKQSSTKKSGHLIRSKLNDQNFKTINNGNNPATEVATSGSSPTQCALDSNSTDSN
KLKNYIIDGVNTENKTNLVIEDEIEYLRVPSVEVPFTSSRKMMMTVHSLSTPNKFGDIFFSNTDSKSNKQTNLQNKVSNS
NSQRYSKTVDNLDSGVYTHVAILKGAPDRIVKHIGFMLNTDWKNEEPMVHIDYSEKINPKEIFEIENTNKVLSGEALRVL
GIAILPLTSEDFFDLVTEECSDKRLQYVLDKNELTLLGLIGFLDPPRPGVEKAITKCCEAGVRVIMITGDQQPTACAIAR
SIGLLADEYEYKNSYEGSADLHNATSGSIICNQLHENGDASRPHLSNELFDKIVSSVSVFCRAQPEDKIAIVRSLQRQGE
VVAMTGDGVNDAPALKAADIGVAMGISGTEVAKGASEMVLLDDNFVTIVNAIEEGRKIYSNVQKFVAFLLGTNIGEIIYL
SIAIAAQLPIPIAALQILFLNLMSDGGPAVALSVDPPDPNMMKVPPRPKKSPIMTRDWWIFGNIPHAIFEAICVLSVLII
SMYTSLGVFQRNAIESLCLHDSNNRYFCQTNEWRLNLIDLEKTGWVTNIDFYNPLTNSMEQILGVTKGKLNSTLSPSEIP
YVKGLYEKAERLGISCVAGKHGWCIPQQKITNDEYIDLVAFGTIRGRTASFIAAVFCEMLRAYTVRTWDWFTKPLFNNPW
LHFACSLSASSTLIVTFTPGLQQIFGTHTIYWWLYILAIGAGFLNMAFDELVPKPLYRRIVERRRIRAKLLAERDVNWIT
RSEQFENT

Proteomics

Found in:

Not found in:

Gene-Specific Links for cgd4_2720

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins