ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

cgd3_3440 (-mtHSP70)

heat shock protein HSP70, mitochondrial, a gene from Cryptosporidium parvum

Compiled localisation
mitochondrion during freshly excysted sporozoite

Who localised this protein by microscopy?

Slapeta, J., Keithly, J. S.
Cryptosporidium parvum mitochondrial-type HSP70 targets homologous and heterologous mitochondria. (2004 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

mitochondrion during freshly excysted sporozoite
  • "Both fluorescein- and immunogold-labeled anti-Cp-mtHSP70 localize to a single mitochondrial compartment in close apposition to the nucleus."
  • Microscopy type: Light, EM
  • Microscopy method: antibody to whole protein without mitochondrial presequence
  • Strain: IOWA
  • Gene model mapping comments: Blast from AY235430, annotation matches
  • Localisation record: mitochondria during freshly excysted sporozoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10225

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>cgd3_3440 heat shock protein HSP70, mitochondrial
MSMIINSSFNGVVNSSGIAARILKRSLPLVFSRYMSSKCEGKKSSNRRITGDIIGIDLGTTNSCTAILEGTQPKVLENSE
GMRTTPSVVAFSEDGQRLVGEVAKRQAITNPENTVYATKRLIGRRYEEEAIKKEQGILPYKIVRADNGDAWVEARGERYS
PSQIGAFILEKMKETAETYLGRGVKHAVITVPAYFNDSQRQATKDAGSIAGLNVTRIINEPTAAALAYGMEKADGKTIAV
YDLGGGTFDISILEILGGVFEVKATNGNTSLGGEDFDQRILNYLIQEFKKTQGIDLSRDKLALQRLREASETAKKELSSK
TQVEINLPFITADARGPKHLQIKLSRAKYEELVDDLLKKTISPSEKCIRDSGIPKEKINDVILVGGMTRMPKVSETVKKI
FGREPSKGVNPDEAVAMGAAIQAGVLKGEIKDLLLLDVTPLSLGIETLGGVFTRLINRNTTIPTKKSQVFSTAADNQTQV
GIKVFQGEREFAADNKLLGQFEMMGIPPAPRGVPQIEVTFDIDANGIMNVGAIDKSTGKKHEITIQSSGGLSGAEIEKMI
REAEEYRANDQAKKELIDLKNDAEAFIYSVQNQISSLADQINTQEKDSLESKISKLQSILQESTQSSDYESAIQSIKSQL
EELKQASWAITQKAYKPGNSDNQSSENYANHEDNSCESQDSDS

Proteomics

Found in:

Not found in:

Gene-Specific Links for cgd3_3440

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins