ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

cgd3_2180 (FAS1 Type I)

type I fatty acid synthase, a gene from Cryptosporidium parvum

Compiled localisation
cytosol and perinuclear during sporozoite

Who localised this protein by microscopy?

Zhu, G., Marchewka, M. J., Woods, K. M., Upton, S. J., Keithly, J. S.
Molecular analysis of a Type I fatty acid synthase in Cryptosporidium parvum. (2000 Feb 5, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytosol and perinuclear during sporozoite
  • "Using rabbit polyclonal antibodies, both free sporozoites and intracellular stages of C. parvum were labelled by immunofluorescent, or immunochemical microscopy. This Type I FAS in C. parvum could be observed intracellularly, and primarily within the perinuclear region (data not shown)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: KSU-1, Iowa
  • Gene model mapping comments: blast from AF082993, annotation matches
  • Localisation record: cytosol and perinuclear during sporozoite
  • Comment: Pictures not shown in paper
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10117

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>cgd3_2180 type I fatty acid synthase
MLNKEEYGPCINSTFSESNSKMNPKNNESNFQDQVSLKDLFSLYGKNPFFYTLKENARINGFRECYSWIGSNGDIKKKFT
YREFFEKVVELSWYLSKKLGIKAGDKVILCYTPGYDFVIAFTTCLVSGIVAVPVYPPDPMRGQSEIQRFCDIKQASETNI
SLTCTSYMRSIEIAKTMSTDKRFKSIRFEATDNLKIRKEEYINEVQKAINDIILNDSNHFDFLGFDFNINTVAFLQFTSG
STSQPKGVMVTHGNLLYNIHICISSYSFPSVLEEHYKNELDSIPAGITVLKKNELTEDELSFIHNEFGEEKNIMSLNDIK
YDKLYLYMSIINKVLYKNTMSSASVFSWLPVYHDMGLIGFFCTPLFFGCNIFQMSPIDFIKKPYLWMQCMDKYNCSVSGA
PNFAFEVVVRKTPKEILNQLNLKHVFAILSGAEPIRKTTIDRFTEAFKSVGIKHNVIKPAYGLAEHTLIVAGSNSFQQEV
NHITVNTKKLREKNIVEIKEAKEKSSTETTSFVSSGIVYKGIDLRIVNPESLKEVTPGNVGEIWISSESVTLGYYNNKEE
TEKTFNANFTMLDGKTSKSTYMRTGDSGFIINDMLYISGRIKDMIIIRGRNFYPQDIEEVIDGVSGVRQGSVAVFSVTQA
DGEEAIGVAVEIRMETSILGRVRRFFEKPAYDNIVRAISKAVFIGHGLPVHYIWLLSPRTILKTSSGKIRRSQTRDAIFS
KKLVPLFEWVCEQSPMSDILVERSSQFISPTSMIISKSGVQNKSKFYEKTHSGQQKISEQANDEKNEFDIDQVKIKIIEF
AAQVLGITQKDLDLNAPLHEYGIDSLGSIRLSEMMNEEFGVELDSTLLFNYPTVIEIVDFVAAQISGKELHRKNLLNRSG
IDSYSDIVVVGMSCSFPGGSSTPGEFWSLLQSGVDAIGEIPKSRWNIDEYYSTDLDLENKMYTKEGGFIENIDQFGASFF
KISHAEARSMDPQQRIFLEKSFEALKDVGYTIDTLKKRNISVFAGCCSNDWTHVCKSEANSNIGTYAATSHAASIIANRV
SYTLGLTGSSVTVDSACSASIVALHVSLQEISTGQCEAAVVGGINLMLSPQITVALCKARMLSMDCRCKSFDAAANGYVR
GEGVGVLVLKTMENANNGEKIYSVIKGSSVNHNGRSASLTAPNGISQQNVINSALEYAGIRPNDIGYIEAHGTGTSLGDP
IEVSALKSIFSRTRDSGKPLIIGAVKTNIGHLEGAAGMAGIFKVILSLINDTVPPNLHFKNINPHINLKGFPVIIPTSNI
ALQTYDGSKTCAGVSAFGFGGTNAHAIFEKPNLSIDLPIKTVKIETNKARNNPVLFVFGFQGFQHVNMGKYYFEREIVYR
EWFLKCCKIIDPFLKISLKSLVYPETKNMEKLRELNKILEQEEYAQCALFAVQYSLAKLLESKGIYPGAVIGLSDGELVA
SVYCGSINLEDGLKLCMLRASLLSEFSAGEGKMALFNVSKEDAEMALADVGPQHNNRVSIFASISSNQVLLSGDEEKLET
VVFILKEYYPRANAHSIDAKFLRTKYSFGTNGMNGLIEPISNLMENIALETPMIPMISGTSGYFVYEELTSPKYWGWQLN
NKLSISKALNTAILNGASTILDLMPISRSEFEISEIFNFENIDKDTIYYSLFEDTNLESYEPNKFNKMIKVVSEILLKNP
YNVEDACDQIINSNGSTYSRESFPWNSFKHSILGEQKSIDRSVKIVSTLNNKSIKLFSDHKVYETIVIPGAGLIDLAAAS
IITVSMDDDSILQGSNALFGESIAVKLNNVLFEKPVVVNRTSLFSSECTEVINQLKSYNNLANDQKTNLICNIESDGSIS
IQYCNIDNQEDFDYEADNSMIDCFSCKAKISEGEFVLSEDLAQLKNNTNIKEDPKIMYEEYEEIGLKYGKKFRVVKEIYR
NETCSIALGKIYLPETCKFGTFESGFYFHPAILDGALHVAGSLLKYKDSFKSKQAMVPVSIEEIEIKYVNANQMIWAAAY
LSEATQNYSIFDLVLFDSEGSCIGKLEKVSLRQFNSKNISRPTVSHNEILWITEWEKSDVLKFSKNISKESDFDLKIALI
HSGICNISEKDDIQLPKANISFVNLDKIKESNIEELERLIDITSLDSLVFLSPVELALSAKIDCEKISIDILEYVMKICK
LYLKILKQAKPTKQEQKINIPNFWIITTNSQNLINYNINENICIPNNSGLWGLAKSANLEISSLLTNFSQPIKSVDLEIT
DFSDNQYLRKTIGSLVRWIGNFEYSSLKEKENLIFKFEREFSITSKNIYVNRINKFHKQIVGPVELFMQNRGSISNLSLI
ESEPIQLEKLNDYEVVMRVKSIGLNFRDVLNVMGLYPGDPGPPGGDCSGTVVAVGEGVKHIKVGDNVFGIAPGCLKTYVT
TDSNLLCKIPKGFTFEQAAALPVVATTVEYSLKDIANIKKGDIVLVHAVTGGVGLMVVQYCKAIGAKVYGTAGSESKVEY
ALSNGVERVSSSRNADKFKEDMKDLEGKVDIVINSLIEDFIPNSLNLLKKGGCFVELGKRGIWTEEEMKEKRPDIKYKCV
AVDVMMEEDPSWFGGMLTRIKNLAEEGIIESLPLKVFDMRGSDENGIDAFRYMQRAQHIGKVIIKIPYLAGIGDNSIPEE
CLITGGSGSLGLVLTETLLNEGITNISIISRSGIESQSDSIKAKWEKLFKRILNNKNGNSGIRFFNIDIGNKDSVYKLIN
TEFKNLKHIFHLAGVLSDSNIETQTRESIEEVFKPKAIGAWNLHNICEELGLNKELKTFVMYSSIASGLGNFGQTNYSAA
NSCLDSLSQYRVSKGLSSRSIQWGAWDEDGMAMNIRQHLGLVGMSPISKTTGQQVIFDLITTQIYEENRKSATIMCLPIK
WKTYINTIYSGENIPQFSLVNTNLRTKRQQNTILLKMSKEERETYIEKQIISLSKSILGVEIKSLDQPLQDIGIDSLAAL
EFRNALSKKFNIKLSATTLFDYPTIRGIKDHISEKLSVKESIYETNKTQISNLILSQDNLSDDNVGVIAGLACRFPGGCN
TPDTLWKSLIRGYSINPLSGKMFNSVGGAFCASREIPIQRWNHNLVYNADPDKTGKCYSYKACFIDSIDMFDNSKFGITN
IEAKHMDPQQRIVLETCYEALVAAKIKEETLIGFQMGVFIGCCSNDWSFLQSRKGMAPFTGTGAANTTISNRVSYVFGMR
GPSMTVDTACASSLTAACIAMDSFRNKECNGAIVGGVNALLSPNLFIAFCKARMLSVDGKCKTFDASADGYVRGEGCGAI
VILKQSEQKKQNTPILGRIKGWGCNHVGRSASLTAPNGPAQTCVIKMALNQSKLNSSDIDYIETHGTGTALGDPIELGAL
KSVFGRNADYKRSTPLVLGALKSNIGHLEGAAGIAGLIKLVLVLKHETAIRIAHLTKINPHLDLEDFNVIIPQKTVSLKC
NKNKLIGGVSGFGFGGCNTHVIVESTEKNKSEDIEAADFSKNHILFVFTGQGSQYINMCKGIYETEPIFRENMNLCNEIV
SKILNISLLDIIYPIDGNKDAEFKAMNMLNDTRYAQPAIFAVEYSLAQLWISKGIKPDSVLGHSLGEFIAATISQVMTIE
DALTLVTHRASIMASTPALDGIMVACRLTESQVVDTIKRFGLEESASLAAVNGQKSVTISGKKESVYKILEYNNVGSRFR
RLDVSHAFHSPLVSEASDKFSKLLENIELKKPTVEFISTVTGKKEIESISTAKYWSKHILNTVRLSDAVYHAIESVNSRM
TFIEITSKPILSQLLKALIPVNSSHISVKCTCKLVNSEIDFIQPLEEMQEFGSENSSFTNHANNLDDDSWRFKLLKRRQI
SWSDISHPIIAPLHDFNDIEWVKENISISKSNARELVEKLEFTCMISPELLDLFDNHKVLGQSILPGAAFVDFMATVALN
YTKSQFTLGVIGAMPDWIQLKGIFFRNPFIMSSAKQYKYLNTQFDSQDYSDEDNSSRSSDFNIIMSKGNNCQISIESSLK
MDEETVVYATCDEVEYVSSIEAQTKSLCIISEWPSSELISNSKKVSQEDIYEKMSIAGLQYGSRFKTLKEMWKVTSNSAV
GIIQSELFTKNCAESPDNLAVYESIMNERGFTIHPTLLDGVLHMCASILGDQSDKETFNELHKRATMVPISINKCLITSK
IDTSKYIKGEKYWAFVQLKSSDKDSAIVNVALKSMSGVPIAVLLGVSLRSVKNGVISTHTIKHVIPNELLWRIDWDEVIE
SITNSEIVSLPTKVNCDNTENESYQGINANLVEKRKVLLLTNSCNISKKELYSEYFTADIVCEASKLSLAEIEATIYGRD
DQELPPSPSNEAKYDLICLHIPNSDKNKAIVSLLPVLYLCKILRSMFENKERLIPRVRIITENIFNVDGMNLEFRTNSGV
APFIKSARQELELFSDQSVSLGLIDIETAEDLNKAIILSFVKDILCFKKREDITSNGTLTESQRLFLNTEYEPELVLKKK
IKGKEDNCEAHYRIITPKLVSLRGEAAIIGSCKLNLSSRGAINNLELLPLSNEERKCPSANTVEIRVRSIGLNFRDVLNV
MGLYPGDPGPPGGDCSGTVVAVGEGVKHIKVGDNVFGIAPGCLKTYVTTDSNLLCKIPKGFTFEQAAALPVVATTVEYSL
KDIANIKKGDIVLVHAVTGGVGLMVVQYCKAIGAKVYGTAGSESKVEYALSNGVERVSSSRNADKFKEDMKDLEGKVDIV
INSLIEDFIPNSLNLLKKGGCFVELGKRGIWTEEEMKEKRPDIKYKCVAVDVMMEEDPSWFGGMLTRIKNLVEEGIIESL
PLKVFDMRGSDENGIDAFRYMQRAQHIGKVIIKIPTPFKYLELDTENHKLNNVGSEKEDRHNNEYGIHVITGGLGGIGRI
IIKWMLEEGVRKIAILSRSANNDSLRDIPEIKDYLNTDIIQIECIKCDVSILSQVESAFREILVKFGETNQIHGIFHAAG
ILMDGAIASQTMEMMESVYAPKVYGAWNLHECCEKFDLNKNLKHFVMFSSVASLLGNFGQTNYSAANSCLDSLVEYRRNK
GMCGTSIQWGPWIEQGMAMNIKQHLEKVGMHGISNEMGIRVINDVILYQNTDLDKNSLGKYPVITCQSFNWNVYMRQLYY
NSKYPSFFKDVVASMSTGEVKNIGMDFRGMSKEEVYSYVKDSVHNIVEQIIGIQSSTLDLDTPFSELGMDSLSAIELRNA
LISRFGIKISSTALFDYPTLRSIIQHLTDSLYVSETRDAFSDLGMSISEREYSVAIIGVSCRLPGRVKSFNDLYEIVLLK
SKDCITEIPLDRWPFDLYYDPDPDNRSKSYVNQGAFITDIDLFDNTFFGLSSTEATNVDPQQKYMLEVAYEAMYNSGITK
RSLTSIKKTAKTGDDPVLMGVFIGCCNTDWHFLQAKFGFENFTSYTGSGGASSLVSNRVSYSFGFRGPSQTIDTACSSSL
VAMDAALKSLKEGSCHTALVGGVNLMLSPHLFVAFCRARMLSPDCRCKTFDASANGYVRGEGCGAILLTKRSEIGGKKIR
PIAYVLGSATNHNGRSASLTAPNGPSQTEVIQNALRNARLTPNDIDYLESHGTGTPLGDPIEFGALKTVFGNKKDIKRSQ
PLILGALKTNIGHLEGAAGVSGLLKLILVLKNRIAPKILHFQKLNPHIDTENFDVEFPTELKPIISNKSKLVGGVSSFGF
GGCNSHVILESASANELNTESSQNKNYPYLIFAYTGQGCQYINMCKQLYDTEEVFRNEMDKCNELLYPILGRSLISTIYC
EKTMESEKLINHTSISQPAIFSIEYSLTKLWESKGIVPSAVMGHSLGEFAAAVTSGILCLKDAITLVARRAEIMASLPQN
DGIMVACRVSEDQVLDSINKLNLKDSAAVAAINGPKSVTISGSRSSVMQVLNNLGMEDRYKQLDVSHAFHSPLVSSAEEK
FEKVIENIQFFEPKLTFFSSVTGNIESKLLIENKYWAQHIIHSVRYYDALETAISTDEENIAIIEIGPKSVLTSMGKQAV
GGIQLVQSSNENISNNELTWIPTIDNSKSNTIDFNDALKAAREYIKYISESVCVHKWNHSRFHWADLTSVHPLLGKFYSS
ISDENYLAYSTDMLKSKVFKNIVEDHVIFDTNIIPAAALIEASACAAFKLQRSEKFPSKYVEMDSMDIEKPLVSNQDETT
SEMEVFVAKSGAIQIRKKCISEAFEYEEEFSGPQIIANDTVFSNSRIYHHASISNSRILSKDEVDKQCFPNLVDYLEKYS
SKDTMEVPIDNIYKMMNEIGLQYQKNYQCLKTVKVKIDNSNDEKKIKSSGSNQINEVFCYVKRPISDFDLTELRIHPGML
DSVFQASSVLFASDELLEGKDTTKNKRGHVAMAPIGFTKCFYGRIQHNSDVWGLVKLNRFEKKGNIAFIDVTLWDSKTNI
LAAHFQDLILKGFSNAASLLSQEVRIPNQFLWRTYNKKIVDRTNYIENSSTFEQENKEDQDKEFNSEDSDHDNQIQKILI
FGIPTVIKELICSKMDNKYKKISTTFICLEEDLTIDLIDQKIQEENWSAMFYLGGLMDNLSSKQVMGDILKISQVISTIS
VSITTAPFVCLTSFNDCKEDGNIPRHSGIKGFVKTARVELENVIGKSINISHIECNSSLVNDPETLMRTISYIASIYEGK
IEEEITLERDLTISESGIYAPRLESINFPVFGAIKLTMSSRGAIGNLKFKPQPQSERVNPPANTVEIRVRSIGLNFRDVL
NVMGLYPGDPGPPGGDCSGTVVAVGEGVKHIKVGDNVFGIAPGCLKTYVITDSNLLCKIPKGFTFEQAAALPVVATTVEY
SLRDIANIKKGDIVLVHAVTGGVGLMVVQYCKAIGAKVYGTAGSESKVEYALSNGVERVSSSRNADKFKEDMKDLEGKVD
IVINSLIEDFIPNSLNLLKKGGCFVELGKRGIWTEEEMKEKRPDIKYKCVAVDVMMEEDPSWFGGMLTRIKNLVEEGIIE
SLPLKVYDMRGSDENGIDAFRYMQRAQHIGKVIIKIPTPFKYLELDTENHKLNNVGSEKEDRHNNEYGIHVITGGLGGIG
RIIIKWMLEEGVRKIAILSRSANNDSLRDIPEIKDYLNTDIIQIECIKCDVSILSQVESAFREILVKFGETNQIHGIFHA
AGILMDGAIASQTMEMMESVYAPKVYGAWNLHECCEKFELNKNLKHFVMFSSVASLLGNFGQTNYSAANSCLDSLVEYRR
NKGMCGTSIQWGPWIEQGMAANLKQHLEKVGMYGISNELGIRVLNDILCFVSKSSSVIGCQSLKWDTFMRRYNTIPTFLS
EVDYSSQGRSQGRVDISKLSDEELVVVIAQVAQQCASSPTLPSPDTVLLDLGLDSLGAVEFRNSVLEMTGVKLPQTLVFE
NPTIYAISMYVRDQNSGNSTKSDSKKHSQTSNEQAKMTIEQWLLSSLKQSERYILYAEAFEKKYQTISNLITETDIISAL
EELGVENNQDYDLLYVSWNELISSEEENSKKQNDSNSKKLEQELIFDPIADVEEIKNSMKLDLDGISTTTDPSEFKTALL
TGVTGFVGRILLVKLIEEFKNMQIVCLVRASSSEKGLERIINVCEEAEVWNPTYASRIIVECGNFEEEYLGLSEERYYEL
CKEIDVVYHIGGDVNLLSNYKRLRKTNTLSLVGIINFCTTIKLKHLHFSSTLGQFPAFFAVFTREFENAVVKETEGPSTR
EMSRLFPPTRQGYPWSKWAAEQILETAHQQGLPLSIYRLPNTYIASDTGYTNKTDYATALLIASILEGMFPIGSSTAPLT
PVNTICEIIISASKKKERKHWRYNLLDTRILGKKHVEAWASQLGLGNYKGVAIDEFFSAIKSRGPESPIFKFVPLMQYWR
HYWFDNTERTQPFPVDTSNVSEDMPEISWPPLEITFQNSFLYCAKRGYFPSNSSSISFTPIKCYSDALNEIKAELSLRNV
NFNQNKYDFICRKMQKNADSIYDSLKKVSLNFCAKYSYYILLKQSIVNQYIVQESLNDSILEKFKMMDCYFITGTSFEEI
LELRRVIRKLLNNYNELKFVDIACPYLPTKNSRRLILEQLKIATSILPLKRFEAVDLDEILTDDSILLEMFMFAPFTLPL
IYGKEYFEEYKNKITGCSEVMEAYSSFKNYIIQTLIKNNYNTEYPIIFSSPFHLPFVKEILQIFENSKIIVVDNKPDNST
IQGKLSMVKSLKSKYTNLDVSEEENSEVYLLDILEEMKHRFVINEPSIDKNRLIYLKDFGEIHNEKISVQLQDFCSTSID
SRF

Proteomics

Found in:

Not found in:

Gene-Specific Links for cgd3_2180

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins