ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

Chro.80255 ()

poly (ADP-ribose) glycohydrolase, a gene from Cryptosporidium hominis

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12124

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • NCLIV_019770 hypothetical protein
  • cgd8_2160 shares a domain with poly(ADP) ribose glycohydrolases, some protein kinase A anchoring proteins and baculovirus HzNV Orf103, possible transmembrane domain within N-terminus
  • Chro.80255 poly (ADP-ribose) glycohydrolase
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>Chro.80255 poly (ADP-ribose) glycohydrolase
MNKIRYLFNEANTWSKITNFISLNHRNVNSRSSLKSFVKDLGVASNDGHIKSSTEKISSKIESSFLNADGTQSSKFFSST
FSVLSECLVKITDNLADNELPRNILTQKTNSIQMFTRKMIVLFLFAGFLGLFPGSFFHNQTPGLDFTGFFSSSRASSNQL
SSFLSYFNIMGHKISQRDPMVSEYVVIQRHHRPPLQEYILTSSSLSLKPTQIISGFMESHNPGGHVVEAIFANKIYGSAT
LHNCMNQEEIVMTVVPETLIGRLFLEDLHDEDSVTIRGVMKYSNYRGFGTNQFTFQSIKEPEMYMSIPRVYAVVDALSRG
SRFREFTLEYALREINKLTSALCDDFYGESEERDRSPFVTGYWGGGVFGGDIQYKFFLQLIAACICNRKLVYSDGSQKLD
IKQIRQIESKYTTCGQLSDAFFKKHKTSGFSKENALKVMLT

Proteomics

Found in:

Not found in:

Gene-Specific Links for Chro.80255

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins