ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

AB480716 (RAP-1c)

gi|255708247|dbj|AB480716.1| Babesia gibsoni BgRAP-1c mRNA for rhoptry-associated protein-1c, complete cds, a gene from Babesia gibsoni

Compiled localisation
cytoplasm and not host cell cytoplasm and not parasite plasma membrane during intracellular merozoite
apical during extracellular merozoite

Who localised this protein by microscopy?

Terkawi, M. A., Amornthep, A., Ooka, H., Aboge, G., Jia, H., Goo, Y. K., Nelson, B., Yamagishi, J., Nishikawa, Y., Igarashi, I., Kawazu, S. I., Fujisaki, K., Xuan, X.
Molecular characterizations of three distinct Babesia gibsoni rhoptry-associated protein-1s (RAP-1s). (2009 Sep, Parasitology) PubMed / full text
   more detail about this publication

cytoplasm and not host cell cytoplasm and not parasite plasma membrane during intracellular merozoite, apical during extracellular merozoite

Orthology

OrthoMCL

This species does not currently exist in the OrthoMCL database.

Amino Acid Sequence

>AB480716 gi|255708247|dbj|AB480716.1| Babesia gibsoni BgRAP-1c mRNA for rhoptry-associated protein-1c, complete cds
MVAPIKFISTLLLATAGSAHAYTSSSAGVKEFLGLKSTPADALAVADVALRASCDAHELMPQMQAYVEGGGEEVVDAVCT
QAGEDTNCREAVAAYLERCAGLDCLTLDVVKYPEGREYQPLALPDPYQLDAAFYVLKHCEGDPFRRQVKEKMALFRGDGQ
YAEFHTFLLNLAINNNQFYRLTAEEQDLDAFVRRYVFMATLFYKTYTLLDVKQARLMDKVGLARHLFGGKIERALKAFIK
RNLPDDFGKYNVARLKHVMDGYGDYMQTQVPALPGFAKRFAVMVTKTLVKSVGHYQKLPWYRRLYRHLTGFFKKNVHEPT
TEFFKETIPGAMRGFAEGTKQRFRRMNDATNAGIQRLGDATIGNFQRMADKTGLQRFVDANAAGFKKFGKATEKAFTNFG
NNTKKLFTGLRGAGNDDEQELVEGGDAEDVEGGDGDE

Proteomics

Found in:

Not found in:

Gene-Specific Links for AB480716

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins