ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

AB083515 (Hsp70)

gi|23867855|dbj|AB083515.1| Babesia gibsoni hsp70 mRNA for heat shock protein 70, complete cds, strain: Korea4, a gene from Babesia gibsoni

Compiled localisation
cell surface during exoerythrocitic

Who localised this protein by microscopy?

Yamasaki, M., Ishida, M., Nakamura, K., Sasaki, N., Murakami, M., Kumara, W. R., Tamura, Y., Lim, S. Y., Ohta, H., Takiguchi, M.
Detection of anti-Babesia gibsoni heat shock protein 70 antibody and anti-canine heat shock protein 70 antibody in sera from Babesia gibsoni-infected dogs. (2011 Aug 25, Vet Parasitol) PubMed / full text
   more detail about this publication

cell surface during exoerythrocitic
  • "This result showed that BgHsp70 would be expressed on the surface of parasites during the exoerythrocytic stage."
  • Microscopy type: Fixed light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: a naturally infected dog in Nagasaki, Japan in 1973
  • Gene model mapping comments: taken directly from 12446097
  • Localisation record: parasite surface during exoerythrocitic
  • Other genes localised in this publication: -

Orthology

OrthoMCL

This species does not currently exist in the OrthoMCL database.

Amino Acid Sequence

>AB083515 gi|23867855|dbj|AB083515.1| Babesia gibsoni hsp70 mRNA for heat shock protein 70, complete cds, strain: Korea4
MHAPAIGIDLGTTYSCVGVYKDNNVEIIPNDQGNRTTPSYVAFTDTERLIGDAAKNQEARNPENTIFDAKRLIGRRFDEA
TVQDDMKHWPFKVINGVGGKPTIEVTFQGQKKTFHPEEISSMVLIKMKEIAELYLGKPVKDAVITVPAYFNDSQRQATKD
AGTIAGLNVMRIINEPTAAAIAYGLDKKGSTEKNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNLLVEH
CVRDFMRINNGKNLATNKRALRRLRTHCERAKRVLSSSTQATIELDSLFEGIDYNTTISRARFEEMCGEKFRGTLIPVEK
ALESSGLDKRKIHEVVLVGGSTRIPKIQQLIKDFFNGKEPSRSINPDEAVAYGAAVQAAILSGDQSGKIQELLLLDVAPL
SLGLETAGGVMTVLIKRNTTIPTKKTQVFTTNENNQEGVFIQVFEGERAMTKDNNLLGKFHLTGIAPAPRGVPQIEVTFD
IDANGILNVTAMDKSTGKSQQVTITNDKGRLSTEDIERMVAEAEKFKEEDENRRSCVEAKHQLENYCYSMRSTLGEEKVR
EKLDAGEVANANAVIDEAIRWLETNQTANKEEFEFKLKEVEKVCQPLATKMYQAAGAGMPTGGPGGFGGAAPGPGAASGP
TVEEVD

Proteomics

Found in:

Not found in:

Gene-Specific Links for AB083515

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins