ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

BBOV_IV011230 (AMA-1)

apical membrane antigen 1, a gene from Babesia bovis

Compiled localisation
apical during merozoite
released into extracellular mileiu during merozoite invasion

Who localised this protein by microscopy?

Gaffar, F. R., Yatsuda, A. P., Franssen, F. F., de Vries, E.
Erythrocyte invasion by Babesia bovis merozoites is inhibited by polyclonal antisera directed against peptides derived from a homologue of Plasmodium falciparum apical membrane antigen 1. (2004 May, Infect Immun) PubMed / full text
   more detail about this publication

apical during merozoite, released into extracellular mileiu during merozoite invasion
  • "Immunofluorescence microscopy showed that there was labeling of the apical half of merozoites with these antisera"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: Israel isolate (clonal line C61411
  • Gene model mapping comments: Blast from AY486101, annotation matches
  • Localisation record: apical during merozoite, released into extracellular mileiu during merozoite invasion
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_27887

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>BBOV_IV011230 apical membrane antigen 1
MQLHYKMQSTSPKYNYKRMLCMVFVPVILSSFFAEDALASNSTLFAFHREPTNRRLTRRASRGQLLNSRRGSDDTSESSD
RYSGRSGGSKNSGQSPWIKYMQKFDIPRNHGSGIYVDLGGYESVGSKSYRMPVGKCPVVGKIIDLGNGADFLDPISSEDP
SYRGLAFPETAVDSNIPTQPKTRGSSSVTAAKLSPVSAKDLRRWGYEGNDVANCSEYASNLIPASDKTTKYRYPFVFDSD
NQMCYILYSAIQYNQGNRYCDNDGSSEEGTSSLLCMKPYKSAEDAHLYYGSAKVDPDWEENCPMHPVRDAIFGKWSGGSC
VAIAPAFQEYANSTEDCAAILFDNSATDLDIEVVNEEFNELKELTSGLKRLNLSKVANAIFSPLSNVAGTSRISRGVGMN
WATYDKDSGMCALINETPNCLILNAGSIALTAIGSPLEYDAVNYPCHIDTNGYVEPRAKTTNKYLDVPFEVTTALSTKTL
KCNAYVHTKYSDSCGTYFLCSDVKPNWFIRFLHMIGLYNTKRIVIFVCCTTTAIVLTIWIWKRFIKAKKEPAPPSFDKYL
SNYDYDTTLDADNETEQRLDSSAYSWGEAVQRPSDVTPVKLSKIN

Proteomics

Found in:

Not found in:

Gene-Specific Links for BBOV_IV011230

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins