ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

BBOV_IV009860 (RAP-1)

rhoptry-associated protein 1 (RAP-1), a gene from Babesia bovis

Compiled localisation
cytoplasm and cytoplasmic accumulation and nucleus and parasitophorous vacuole membrane during intracellular merozoite
during merozoite
not erythrocyte cytoplasm during merozoite
erythrocyte cytoplasm during shortly after merozoite invasion

Who localised this protein by microscopy?

Suarez, C. E., Laughery, J. M., Bastos, R. G., Johnson, W. C., Norimine, J., Asenzo, G., Brown, W. C., Florin-Christensen, M., Goff, W. L.
A novel neutralization sensitive and subdominant RAP-1-related antigen (RRA) is expressed by Babesia bovis merozoites. (2011 Apr 18, Parasitology) PubMed / full text
   more detail about this publication

during merozoite
  • "Additionally, the results suggest that RRA is present at lower levels when compared to RAP-1 in cultured merozoites. "
  • Microscopy type: Fixed light
  • Microscopy method: monoclonal antibody BABB75A4
  • Strain: Mo7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: during merozoite
  • Other genes localised in this publication: RAP-1 related antigen (RRA)

Terkawi, M. A., Seuseu, F. J., Eko-Wibowo, P., Huyen, N. X., Minoda, Y., AbouLaila, M., Kawai, S., Yokoyama, N., Xuan, X., Igarashi, I.
Secretion of a new spherical body protein of Babesia bovis into the cytoplasm of infected erythrocytes. (2011 Jul-Aug, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

erythrocyte cytoplasm during shortly after merozoite invasion
  • "To further define the secretion of BbSBP-4, co-localization studies were carried out with rabbit immune sera specific to rBbRAP-1 and rBbSBP-1 [12], known as secreted proteins within the cytoplasm of infected RBC."
  • Microscopy type: Fixed light
  • Microscopy method: antibody
  • Strain: Texas
  • Gene model mapping comments: inferred from another publication
  • Localisation record: infected RBC during shortly after merozoite invasion
  • Other genes localised in this publication: spherical body protein 4 SBP4, 85 kDa protein

Mesplet, M., Echaide, I., Dominguez, M., Mosqueda, J. J., Suarez, C. E., Schnittger, L., Florin-Christensen, M.
Bovipain-2, the falcipain-2 ortholog, is expressed in intraerythrocytic stages of the tick-transmitted hemoparasite Babesia bovis. (2010, Parasit Vectors) PubMed / full text
   more detail about this publication

not erythrocyte cytoplasm during merozoite
  • "As expected [27], anti-rhoptry associated protein-1 (RAP-1) monoclonal antibodies tested on the same smears yielded a punctuated pattern, with no erythrocyte cytoplasm reaction (Fig. 6D), and normal mice serum gave no signal (Fig. 6E)."
  • Microscopy type: Fixed light
  • Microscopy method: monoclonal antibody
  • Strain: BboS2P, RAD
  • Gene model mapping comments: inferred from another publication
  • Localisation record: punctuated and not erythrocyte cytoplasm during merozoite
  • Other genes localised in this publication: cysteine protease 2

Yokoyama, N., Suthisak, B., Hirata, H., Matsuo, T., Inoue, N., Sugimoto, C., Igarashi, I.
Cellular localization of Babesia bovis merozoite rhoptry-associated protein 1 and its erythrocyte-binding activity. (2002 Oct, Infect Immun) PubMed / full text
   more detail about this publication

cytoplasm and cytoplasmic accumulation and nucleus and parasitophorous vacuole membrane during intracellular merozoite
  • "In the early phase of merozoite development (the ring and subsequent pear-shaped forms), RAP-1 appeared as a dense accumulation in the parasite cytoplasm (Fig. 1A), which later thinned out and blanketed the host cell cytoplasm (Fig. 1B), but retained a denser mass or accumulation around the nuclei of extracellular merozoite (Fig. 1C). In the host cell, RAP-1 showed preferential accumulation on the inner cell membrane, and near the merozoite, it was observed by IEM bordering the parasite's outer surface with the MAb 1C1 (Fig. 2A)."
  • Microscopy type: light, EM
  • Microscopy method: monoclonal antibody directly to protein
  • Strain: T2B
  • Gene model mapping comments: Blast from AAC27386.1, annotation matches
  • Localisation record: inner surface of host cell cytoplasm and cytoplasm and cytoplasmic accumulations and nucleus during intracellular merozoite
  • Comment: RAP-1 appears to be 2 genes tandemly repeated with exactly the same sequence BBOV_IV009860 and BBOV_IV009870
  • Other genes localised in this publication: -

Orthology

OrthoMCL

No entry found in OrthoMCL.

Amino Acid Sequence

>BBOV_IV009860 rhoptry-associated protein 1 (RAP-1)
MRIISGVVGCLFLVFSHHVSAFRHNQRVGSLAPAEVVGDLTSTLETADTLMTLRDHMHNITKDMKHVLSNGREQIVNDVC
SNAPEDSNCREVVNNYADRCEMYGCFTIDNVKYPLYQEYQPLSLPNPYQLDAAFRLFKESASNPAKNSVKREWLRFRNGA
NHGDYHYFVTGLLNNNVVHEEGTTDVEYLVNKVLYMATMNYKTYLTVNSMNAKFFNRFSFTTKIFSRRIRQTLSDIIRWN
VPEDFEERSIERITQLTSSYEDYMLTQIPTLSKFARRYADMVKKVLLGSLTSYVEAPWYKRWIKKFRDFFSKNVTQPTKK
FIEDTNEVTKNYLKANVAEPTKKFMQDTHEKTKGYLKENVAEPTKTFFKEAPQVTKHFFDENIGQPTKEFFREAPQATKH
FLDENIGQPTKEFFREAPQVTKHFLDENIAQPTKEFFRDVPQVTKKVITENIAQPTKEFLKEVPHTTMKVLNENIAQPAK
EIIHEFGTGAKNFISAAHEGTKQFLNETVGQPTKEFLNGALETTKDALHHLGKSSDEANIYDASENTTQSNDSTTSNGED
TAGYL

Proteomics

Found in:

Not found in:

Gene-Specific Links for BBOV_IV009860

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins