ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

BBOV_IV007730 (bovipain-2)

cysteine protease 2, a gene from Babesia bovis

Compiled localisation
erythrocyte cytoplasm and middle-rear during merozoite

Who localised this protein by microscopy?

Mesplet, M., Echaide, I., Dominguez, M., Mosqueda, J. J., Suarez, C. E., Schnittger, L., Florin-Christensen, M.
Bovipain-2, the falcipain-2 ortholog, is expressed in intraerythrocytic stages of the tick-transmitted hemoparasite Babesia bovis. (2010, Parasit Vectors) PubMed / full text
   more detail about this publication

erythrocyte cytoplasm and middle-rear during merozoite
  • "Immunofluorescence studies showed an intracellular localization of bovipain-2 in the middle-rear region of in vitro cultured merozoites, as well as diffused in the cytoplasm of infected erythrocytes."
  • Microscopy type: Fixed light
  • Microscopy method: antibody
  • Strain: BboS2P, RAD
  • Gene model mapping comments: blast from XP_001610695, annotation matches
  • Localisation record: Middle-rear and erythrocyte cytoplasm during merozoites
  • Other genes localised in this publication: rhoptry-associated protein 1 (RAP-1)

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12656

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>BBOV_IV007730 cysteine protease 2
MEIPAAASDLSNLDDHYVRSDDEVRDTTLIGRSRRCCVGKKTMWIVLLGTAILTAAITSGIILLVTSLSGSKAKPSGGVK
HIGKFDGLNRADCHVSPETFAELSSMAHLGEINVSDPAEIVKYMDFTRMAKKFDRKYDTVAERHTAFLNFRRNHDIVKSH
EHNKAATYTKDLNHFFDKDIKAVAAKLLHKIDVYNESNISVTPTDTTATKENQPIYATLKNYSVSAGYPPIGSKVNFEDI
DWRRADAVTPVKDQGMCGSCWAFAAVGSVESLLKRQKTDVRLSEQELVSCQLGNQGCNGGYSDYALNYIKFNGIHRSEEW
PYLAADGKCVAHDGTKYYIKGYHAAKGRSVANQLLVMGPTVVYIAVSEDLMHYSGGVFNGECSDSELNHAVLLVGEGYDS
ALKKRYWLLKNSWGTSWGEDGYFRLERTNTPTDKCGVLSYGYVPY

Proteomics

Found in:

Not found in:

Gene-Specific Links for BBOV_IV007730

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins