ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

BBOV_IV005390 (SBP-4)

spherical body protein 4 SBP4, a gene from Babesia bovis

Compiled localisation
not microneme and not nucleus and spherical body organelle during early cell division and early extracellular merozoite and trophozoite
erythrocyte cytoplasm during intracellular merozoite

Who localised this protein by microscopy?

Terkawi, M. A., Seuseu, F. J., Eko-Wibowo, P., Huyen, N. X., Minoda, Y., AbouLaila, M., Kawai, S., Yokoyama, N., Xuan, X., Igarashi, I.
Secretion of a new spherical body protein of Babesia bovis into the cytoplasm of infected erythrocytes. (2011 Jul-Aug, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

spherical body organelle and not microneme and not nucleus during early cell division and early extracellular merozoite and trophozoite, erythrocyte cytoplasm during intracellular merozoite
  • "The immunoelectron microscopic examination confirmed the localization of BbSBP-4 in spherical bodies, but not in the nucleus, rhoptries, and micronemes. Interestingly, the protein was found to be localized not only in the spherical body of Babesia bovis but also in the cytoplasm of infected erythrocytes (iRBC) at the later stage of parasite development."
  • Microscopy type: Fixed light, EM
  • Microscopy method: antibody
  • Strain: Texas
  • Gene model mapping comments: blast from AF486506, annotation matches
  • Localisation record: spherical body and not nucleus and not micronemes during early phase of single merozoite and ring and early cell division, RBC during late stages
  • Other genes localised in this publication: rhoptry-associated protein 1 (RAP-1), 85 kDa protein

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>BBOV_IV005390 spherical body protein 4 SBP4
MVAISLRHVLLFAAISYAKVFAEEEETDEYPIEVEEPYDELLEEANVQVHGAPNAMSLNLLMPVNTHRILKTSEFDSAHT
PVHYKPLFPFKLVSVSWSESPIFEIPVPEEEQGKEEKTEETETKSEEDGEEAEGADEAAPAILHADLQNKFIDEVVVFRN
CFDTAVSVNVDGKQIYFTATGNEAEDFEEVEADEYEKFMNKIAKTFTIDISETDLKSECLVAEDDKVYDLSWYSIHAAPC
YLADKVLFKGNPLWEATDKKEHFAGCSVINDGDDRLIALSIRNGPENRQIYFYGVDGALREIDNDEMVTHYEAFKEKEQA
ERERYEAEEKARLEAEKDAEKEEEENKEGAEEDEEEEEEVAEEEEITADIEE

Proteomics

Found in:

Not found in:

Gene-Specific Links for BBOV_IV005390

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins