ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

BBOV_II004970 (TPx-1)

thioredoxin peroxidase-like protein, a gene from Babesia bovis

Compiled localisation
cytoplasm during intracellular merozoite

Who localised this protein by microscopy?

Tanaka, M., Sakurai, T., Yokoyama, N., Inoue, N., Kawazu, S.
Cloning and characterization of peroxiredoxin in Babesia bovis. (2009 Oct, Parasitol Res) PubMed / full text
   more detail about this publication

cytoplasm during intracellular merozoite
  • "As a result, green fluorescence indicating BbTPx-1 was observed around the nucleus (red signals) of B. bovis merozoites in bovine RBC (Fig. 3). From this result, it was confirmed that BbTPx-1 was expressed in the cytoplasm of B. bovis merozoites."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: Texas
  • Gene model mapping comments: Blast from XM_001609969, annotation matches
  • Localisation record: cytoplasm during intracellular merozoite
  • Comment: sequence not deposited in genbank, but length matches gene prediction
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10063

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>BBOV_II004970 thioredoxin peroxidase-like protein
MIAVGQPAPNFRCEAVMPDNSFKEISLSDYAGKKYVCLFFYPLDFTFVCPTEIVAFNDAMAQFEARNVQILACSVDSKFA
HVTWRNTPRDKGGIGNVMFPVLTDITKTVCDAYEVLIPEEGVALRGLFLIDKKGIVQHLQINNLPLGRSVTEVLRIIDAL
QFYEKHGEVCPANWKAGDKGMAATTEGVIAHLTSKHS

Proteomics

Found in:

Not found in:

Gene-Specific Links for BBOV_II004970

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins