ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

BBOV_II002880 (Bb-1, SBP-1)

85 kDa protein, a gene from Babesia bovis

Compiled localisation
spherical body organelle during merozoite invasion
cytoplasmic face of host erythrocyte membrane during intracellular merozoite
not host erythrocyte membrane
cytoplasm during extracellular merozoite and merozoite invasion and shortly after merozoite invasion
erythrocyte membrane during intraerythrocytic and rupturing form and trophozoite

Who localised this protein by microscopy?

Terkawi, M. A., Seuseu, F. J., Eko-Wibowo, P., Huyen, N. X., Minoda, Y., AbouLaila, M., Kawai, S., Yokoyama, N., Xuan, X., Igarashi, I.
Secretion of a new spherical body protein of Babesia bovis into the cytoplasm of infected erythrocytes. (2011 Jul-Aug, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytoplasm during extracellular merozoite and merozoite invasion and shortly after merozoite invasion, erythrocyte membrane during intraerythrocytic and rupturing form and trophozoite
  • "At the early stage of the ring form, BbSBP-1 was detected within the cytoplasm of the parasite in a pattern overlapped by BbSBP-4 (Fig. 3A, panel f), while, at a later stage, BbSBP-1 appeared to be uniformly distributed throughout the cytoplasm with high intensity near the membrane of infected RBC, persisting throughout the developmental stages of parasites (Fig. 3A, panels g-j)."
  • Microscopy type: Fixed light
  • Microscopy method: antibody
  • Strain: Texas
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytoplasm during free merozoites and merozoite invasion and after merozoite invasion, infected RBC membrane during ring stage and sequentially dividing forms and rupturing form
  • Other genes localised in this publication: spherical body protein 4 SBP4, rhoptry-associated protein 1 (RAP-1)

Hines, S. A., Palmer, G. H., Brown, W. C., McElwain, T. F., Suarez, C. E., Vidotto, O., Rice-Ficht, A. C.
Genetic and antigenic characterization of Babesia bovis merozoite spherical body protein Bb-1. (1995 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

spherical body organelle during merozoite invasion, cytoplasmic face of host erythrocyte membrane during intracellular merozoite, not host erythrocyte membrane
  • "A Babesia bovis merozoite protein, Bb-1, was localized by immunoelectron microscopy to an apical organelle known as the spherical body."
  • Microscopy type: light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: Mexico (Mo7)
  • Gene model mapping comments: Blast from M99575, annotation doesn't match
  • Localisation record: spherical body organelles during invading merozoites, cytoplasmic face of host erythrocyte membrane during intracellular merozoite, not host cell surface
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_45854

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>BBOV_II002880 85 kDa protein
MSGHLVCKSGFGLGKVAKLMLASVVVLSAFSGNVWANEAEVSQVVKPGSVNGWWFTKGEYDVDPEWNEADIVYDDYKKYN
GFSDMDKTESTEKTSLGDIFMKLGPKKCMNLRVKDVDVDMQRANRRLATILQHITDHTPESPMFAVSENIVKALNKQHTI
ELPKALAQQLCQFDAKAMKTDESRQFKDAFSTFFADFVADVLLGYSPMSEHMGVRCKAFSQIKKHVLLSLNGIENLDKDS
CVNVTQPAIPTIPEQPVAEEPSDVTVTAPEECEEEVVINPEEENKPDSSSSSSSSSSSSSESDSDEEDREPIVEEPVVEE
PVVEEPAETPAETPAETPAETPAETPAETPAETPAETPAETPAETPAETPAETPAETPAETPAETPAEKPAEKPAEKPAE
KPAEKPASRPCYGGRKGEEVVVLQTTSTNQTPLKELPVVTGPSTNRLWHENVDIDMPVVQKRLSTILGYVTNYDPKHPFF
AVSENIVKVLNDSCKFALPEDLAVELSSIESGKIFGYEWEVFTQIFADYLSLVVMNGLCGPRPASRKESEPWLRNYYETK
NHIVRSLNKIQMLD

Proteomics

Found in:

Not found in:

Gene-Specific Links for BBOV_II002880

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins