ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

BBOV_II002650 (TRAP)

thrombospondin-related anonymous protein, a gene from Babesia bovis

Compiled localisation
apical during merozoite
released into extracellular mileiu during merozoite invasion

Who localised this protein by microscopy?

Gaffar, F. R., Yatsuda, A. P., Franssen, F. F., de Vries, E.
A Babesia bovis merozoite protein with a domain architecture highly similar to the thrombospondin-related anonymous protein (TRAP) present in Plasmodium sporozoites. (2004 Jul, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apical during merozoite, released into extracellular mileiu during merozoite invasion
  • "In contrast to Plasmodium TRAP, BbTRAP was shown to be present during the asexual erythrocytic cycle, being located mainly at the apical side of merozoites...antisera recognized a 75 kDa protein in merozoite extracts as well as in a protein fraction that was secreted into the extracellular milieu during in vitro invasion of erythrocytes"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: Israel strain, clonal line C61411
  • Gene model mapping comments: Blast from AAS58046, annotation matches
  • Localisation record: apical during merozoite, released into extracellular mileiu during merozoite invasion
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_33736

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PVX_082735 sporozoite surface protein 2
  • PCHAS_135440 thrombospondin-related anonymous protein, putative
  • PKH_121770 sporozoite surface protein 2, putative
  • TA07755 thrombospondin-related protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>BBOV_II002650 thrombospondin-related anonymous protein
MIGYIKILASVPLLSLAFLATTGLHAFADKGVGSPKGKQCKKQLDFSIVVDESASISNDQWEGQMIPFLRNLIHTVDLDN
TDIRLSLTTYSTPTRQIFTFLDAAASSTRLALTKLDWMAGTKARSGMTYTGRALNYVRKAILPYGRKNVPKALLLITDGV
SSDGSYTAQVAAMLRDEGVNVMVIGVGDVNVAECRGIVGCDGVMDCPMFKHTNWKDIMGLFNSLMKEVCDILPQDAVCEP
VWAEWSSCKGECGVPGTRTRALLDLRMIEKPVNGSNGQPGKSCEDQKMNFLPQSETCTIECNHEPVPSSPVPIPHDMDHP
EPSRATPEGDLDHSHSSIPSTPDMSSSSTDMPSSSSDMPSSPTDMSSSTTDMPSSTTDMPSSTTDMSSSTTDMPSSTTDM
SSSTTDMPSSPTDMPSSTTDMPSSPTHTRVEETDEEHNHRKDMDIKFPENMDDIPVEDIPMPIDPRHGVEPSASDVIPED
DQLRKKLEMQREEDLRKELMLQHELKLQEEKERAAILENNTPYGSATSVSQGGESTTGLPQSSEADAISHDVYDNHPEES
ENTGINAEVTESEDYEGEKQNDESNARSTSNTTKIAGGALLGLLLLGAGGGYAMYKKNKTPTVETESGDYTGADESAEPM
KEGDTYTVTEFDNNIWGEAA

Proteomics

Found in:

Not found in:

Gene-Specific Links for BBOV_II002650

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins