ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

BBOV_II000740 (SBP2, 225-kDa)

Spherical Body Protein 2 (SBP2), a gene from Babesia bovis

Compiled localisation
spherical body organelle during merozoite invasion
host erythrocyte membrane during intracellular merozoite

Who localised this protein by microscopy?

Dowling, S. C., Perryman, L. E., Jasmer, D. P.
A Babesia bovis 225-kilodalton spherical-body protein: localization to the cytoplasmic face of infected erythrocytes after merozoite invasion. (1996 Jul, Infect Immun) PubMed / full text
   more detail about this publication

spherical body organelle during merozoite invasion, host erythrocyte membrane during intracellular merozoite
  • "A 225-kDa Babesia bovis protein occurs on the cytoplasmic side of infected-erythrocyte membranes. Here it is demonstrated that the 225-kDa protein localizes to spherical-body organelles of merozoites."
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody
  • Strain: Mexico (Mo7)
  • Gene model mapping comments: Blast from XP_001609602, annotation matches
  • Localisation record: spherical body organelles during invading merozoites, host erythrocyte membrane during intracellular merozoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_22246

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>BBOV_II000740 Spherical Body Protein 2 (SBP2)
MAVTARNNGFRKVAKWIVGAVVVASASSANVVGYELMSDDHTFFARPGYDINGSPIVYENFFGKDFSERDVDVIIGHDLE
DHKNFRTPQYAELKRRDVVREMFYFDLILQRLPIDVAQEASEYATFSMLPDDLARKVKIRHYNRLYPGLLQQLPDYLIEK
ALKCNIYEGISPDVMLEIEYYLKVKNRWKPMSPEIIRDTNDENMDTNDSKPAQVTPTTPSPSITDEVIQLPEYVDGPVVF
PSHIDDEIIQLPDYEDSPIVLPIETEIEGSESSESSSSDSEGEEITLPEDSGVEEPDDDVIQLPEYVDSPIVLPIETEIE
GSESSESSSSDSEGEEITLPEDSGVEEPDDDVIQLPEYVDGPVVFPSHIDDEIIQLPDYEDSPIVLPIETEIEGSESSES
SSSDSEGEEITLPEDSGVEEPDDDVIQLPEYVDGPVVFPSHIDDEIIQLPDYEDSPIVLPIETEIEGSESSESSSSDSEG
EEITLPEDSGVEEPDDDVIQLPEYVDGPVVFPSHIDDEIIQLPDYEDSPIVLPIETEIEGSESSESSSSDSEGEEITLPE
DSGVEEPDDDVIQLPEYVDGPVVFPSHIDDEIIQLPDYEDSPIVLPIETEIEGSESSESSSSDSEGEEITLPEDSGVEEP
DDDVIQLPEYVDGPVVFPSHIDDEIIQLPDYEDSPIVLPIETEIEGSESSESSSSDSEGEEITLPEDSGVEEPDDDVIQL
PEYVDGPVVFPSHIDDEIIQLPDYEDSPIVLPIETEIEGSESSESSSSDSEGEEITLPEDSGVEEPDDDVIQLPEYVDGP
VVFPSHIDDEIIQLPDYEDSPIVLPIETEIEGSESSESSSSDSEGEEITLPEDSGVEEPDDDVIQLPEYVDGPVVLPIET
EIEGSESSESSSSDSEGEEIKLPEDSGVEEPDDDVIQLPEYVDGPVVLPIETEIEGSESSESSGSDSEGEEITLPEDSGV
EEPDDDVIQLPEYVDGPVVFPGHIFDEIDATLPEDSGVEEPDDDVIQLPEYVDGPVVFPSHIDDEIDATLPEDSGVEEPD
DDVIQLPEYVDSPVVLPIETEIEGSESSESSTSDSEGEEITLPEDSGVEEPDDDVIQLPEYVDSPIVLPIETEIEGSESS
ESSGSDSEGEEITLPEDSGVEEPDDDVIQLPEYVDGPVVLPIETEIEGSESSESSGSDSEGEEITLPEDSGVEEPDDDVI
QLPEYVDGPVVFPSHIDDEIIQLPDYEDSPIVLPIETEIEGSESSESSSSDSEGEEITLPEDSGVEEPDDDVIQLPEYVD
SPIVLPIETEIEGSESSESSGSDSEGEEITLPEDSGVEEPDDDVIQLPEYVDGPVVFPGHIFDEIDATLPEDSGVEEPDD
DVIQLPEYVDGPVVFPSHIDDEIIQLPDYEDSPIVLPIETEIEGSESSESSGSDSEGEEITLPEDSGVEEPDDDVIQLPE
YVDGPVVFPGHIFDEIDATLPEDSGVEEPDDDVIQLPEYVDSPIVLPIETEIEGSESSESSGSDSEGEEITLPEDSGVEE
PDDDVIQLPEYVDGPVVLPIETEIEGSESSESSGSDSEGEEITLPEDSGVEEPDDDVIQLPEYVDSPIVLPIETEIEGSE
SSESSGSDSEGEEITLPEDSGVEEPDDDVIQLPEYVDSPIVLPIETEIEGSESSESSGSDSEGEEITLPEDSGVEEPDDD
VIQLPEYVDGPVVLPIETEIEGSESSESSSSDSEGEEITLPEDSGVEEPDDDVIQLPEYVDGPVVLPIETEIEGSESSES
SSSDSEGEEITLPEDSGVEEPDDDVIQLPEYVDGPVVLPIETEIEGSESSESSSSDSEGEEIKLPEDSGVEEPDDDVIQL
PEYVDGPVVLPIETEIEGSESSESSGSDSEGEEITLPEDSGVEEPDDDVIQLPEYVDGPVVFPGHIFDEIDATLPEDSGV
EEPDDDVIQLPEYVDSPIVLPIETEIEGSESSESSGSDSEGEEITLPEDSGVEEPDDDVIQLPEYVDGPVVFPSHIDDEI
DVTLPEDSGVEEPDDDVIQLPEYLDGPVVLPIETEIEGSESSESSSSESNISGVVSPAGISHIEDPVADEIGIPTDYIFI
NCIGKGFTSKDVDDIVASKPCMTSRGQAVPPTRDVVLRRMDKYNRILMYLPENIRKEAGQYAIFELLPSDFANEVKAAHF
NRIYVNLLKSLPQELVEKCLACDIYEGISFETMAEVIDYFDDLQDDFFDTVRKPVVVRSPAKTEAAQGASKPNAVKPVPA
EVDEQCAA

Proteomics

Found in:

Not found in:

Gene-Specific Links for BBOV_II000740

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins