ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

BBOV_I004210 (SBP3)

spherical body protein 3, a gene from Babesia bovis

Compiled localisation
spherical body organelle during merozoite invasion
cytoplasmic face of host erythrocyte membrane during intracellular merozoite
not host erythrocyte membrane

Who localised this protein by microscopy?

Ruef, B. J., Dowling, S. C., Conley, P. G., Perryman, L. E., Brown, W. C., Jasmer, D. P., Rice-Ficht, A. C.
A unique Babesia bovis spherical body protein is conserved among geographic isolates and localizes to the infected erythrocyte membrane. (2000 Jan 5, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

spherical body organelle during merozoite invasion, cytoplasmic face of host erythrocyte membrane during intracellular merozoite, not host erythrocyte membrane
  • "The protein was localized to the spherical bodies of the babesial apical complex and was designated spherical body protein 3 (SBP3), according to the established nomenclature. Immunofluorescence studies showed binding of the 70/52.9 mAb to the infected-erythrocyte membrane region but not to their uninfected counterparts, demonstrating a host-cell association shared with the previously isolated B."
  • Microscopy type: light, EM
  • Microscopy method: monoclonal antibody
  • Strain: Mexico (Mo7)
  • Gene model mapping comments: Blast from AF107117, annotation matches
  • Localisation record: spherical body organelles during invading merozoites, cytoplasmic face of host erythrocyte membrane during intracellular merozoite, not host cell surface
  • Other genes localised in this publication: -

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>BBOV_I004210 spherical body protein 3
MRRFLLVALLAATAAAQVVDENVDNYQHELDDNYMPVFTEKQLENPVIVPLDITSGIHEETYNAKSFMSKDGKIMSTVFH
APSDALFKAINHGVTTIFNPETFLSYKVIVDYVDKEAYYVRIFGIVKRGVYGVRYLINTNDGFVKVSRAEYNRHRAQYST
PYTLDLCAQKSELLEKNIVEEHPESPQEFTSYQPQFNYHINEVVAGPVKLCEFDPAKAGTGMKVMTYNFDGKKYCVVQAV
NIDGGMEEHVFVETEEGFTRISDRQRDGFFTPASEETTTSSEETDEDGCGATDDQPDQEGVINYTQLTPPSQHISKMFSQ
LQFLKVNIRQSPRENGPWTRTTYQNGNGCHETMITAQQGYVIYRLVDNSRLIWERPGLALTNATLMNNLNGEEFLQLEVL
AEDGSSFNYYFSKYDDKWHPITRERARELANPNKIGTVEEKIHLKCPDLSQHDLDRLKCTTSLPFDTTIDCHYAWLTDSV
SEGAMLTRKLCTAMDEYYSFNSFITARDVIMDLKDQYRSTQAIHYKAVGLELLGFNAFDLNTGRCSLQFYLRRENRWIRI
DQAVFYQRINDVLEFIFLKRRQAANGTDLSDDAVLNDEMANYVLSAMHTFQHRDIDTDLPMKHEYDSHTGGYNVGKNLPH
DRECSGSTECHCPCKCKCTCNQTAAEKNAALEHISLELHCKQDNRYKIHAVTGRDGSTRINFKPSEGYKFAEITEGGILI
FKNPEFNITDAIIDISTDGQYFLQVLGFDHKGEQHIYYLYKAKKAHTFTEVCRRTYVSMRYRTMTRTAVNVNSHNTGNPN
LIRFRSRHYGKVQSFVPRYNCIIDRVHHENTTIWTYDELNPEVILRVVTFVRDNIRGVLLQLIDYESREVDRLYLNTNPQ
TNEYVPFLHKGEMFSLFKTYLLNRRTGLPGFRTYRENDIDWTREILPGSHDHNRIHSKRYIAPSAYDVSEYLLRKEEEEE
TCPCKEKEAELARRKAREDLNGMSAEEVAKKAAIEAKHVHMQNVKDNSYYSGVPLTLSNVVHKEGVVWDSNGTGEVCLDY
RKFDKGQYRLVECDIMTPDGRVEVRYFMNTHNGRGHYKEVELCRVGMDV

Proteomics

Found in:

Not found in:

Gene-Specific Links for BBOV_I004210

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins